Property Summary

NCBI Gene PubMed Count 39
PubMed Score 350.28
PubTator Score 222.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
periodontitis 269 1.20999191052111E-15
lung carcinoma 2844 1.29286177070347E-15
breast carcinoma 1614 5.20582319399706E-12
malignant mesothelioma 3163 4.94498049380315E-10
lung cancer 4473 2.07371915007179E-7
Common variable immunodeficiency 98 2.7300759099765E-6
X-linked agammaglobulinemia 7 3.93329460125349E-6
osteosarcoma 7933 4.7985878905774E-6
chronic lymphocytic leukemia 244 7.33020814677332E-4
psoriasis 6685 7.85172340481489E-4
posterior fossa group A ependymoma 1511 0.00192495019233703
tuberculosis 1563 0.0025500311567106
Waldenstrons macroglobulinemia 765 0.0047858335857487
cutaneous lupus erythematosus 1056 0.00711584248627571
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00984700141462108
lung adenocarcinoma 2714 0.0110842547035324
adult high grade glioma 2148 0.0119921850664837
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0125055616758622
pituitary cancer 1972 0.0195429879502306
Breast cancer 3099 0.0215258560780546
colon cancer 1475 0.0264025207843232
active ulcerative colitis 477 0.0265621668372633
pancreatic cancer 2300 0.0294401894447338
primary pancreatic ductal adenocarcinoma 1271 0.038273648124501
mucosa-associated lymphoid tissue lymphoma 480 0.0433813400562077
chronic kidney disease 90 0.0446843342941263

Expression

Synonym

Accession P01591
Symbols IGJ
JCH
IGCJ

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (2)

PMID Text
20947433 TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE      1 - 70
NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY     71 - 140
GGETKMVETALTPDACYPD                                                       141 - 159
//

Text Mined References (45)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24706782 2014 Expression and glycoengineering of functionally active heteromultimeric IgM in plants.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
More...