Property Summary

NCBI Gene PubMed Count 39
Grant Count 36
R01 Count 14
Funding $3,520,157.67
PubMed Score 350.28
PubTator Score 222.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20947433 TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE      1 - 70
NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY     71 - 140
GGETKMVETALTPDACYPD                                                       141 - 159
//

Text Mined References (45)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24706782 2014 Expression and glycoengineering of functionally active heteromultimeric IgM in plants.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
More...