Property Summary

NCBI Gene PubMed Count 349
PubMed Score 6789.50
PubTator Score 2458.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.700 4.7e-06

Protein-protein Interaction (1)

Gene RIF (334)

AA Sequence

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ      1 - 70
FQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS     71 - 140
LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN                           141 - 187
//

Text Mined References (351)

PMID Year Title