Property Summary

NCBI Gene PubMed Count 323
Grant Count 702
R01 Count 377
Funding $144,665,258.21
PubMed Score 6507.54
PubTator Score 2458.51

Knowledge Summary

Patent

No data available

Synonym

Accession P01574 Q5VWC9 IFN-beta
Symbols IFB
IFF
IFNB
IFN-beta

Gene

PDB

1AU1  

Gene RIF (313)

PMID Text
26819312 the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3
26609934 Together, the data demonstrate that interferon-beta inhibits foamy virus early in infection and that MxB is not a restriction factor of foamy virus.
26608320 These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production.
26602079 Data suggest microRNA-302c regulates interferon-beta production in innate/mucosal immunity partly via down-regulation of interferon regulatory factors IRF3/7; studies were conducted in lung epithelial cells infected with influenza A virus H3N2.
26474372 The C-terminal region of Toscana Virus NSs protein is critical for interferon-beta antagonism and protein stability.
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26397698 IFN-b could be an effective agent not only through its cell growth inhibitory effect on GSCs but also as a means of targeting the interconversion between GSCs and non-GSCs.
26372645 Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis.
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
More...

AA Sequence

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ      1 - 70
FQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS     71 - 140
LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN                           141 - 187
//

Text Mined References (325)

PMID Year Title
26819312 2016 Suppression of Type I Interferon Production by Human T-Cell Leukemia Virus Type 1 Oncoprotein Tax through Inhibition of IRF3 Phosphorylation.
26609934 2016 Interferon but not MxB inhibits foamy retroviruses.
26608320 2015 PACT- and RIG-I-Dependent Activation of Type I Interferon Production by a Defective Interfering RNA Derived from Measles Virus Vaccine.
26602079 2015 Mir-302c mediates influenza A virus-induced IFN? expression by targeting NF-?B inducing kinase.
26474372 2015 Truncation of the C-terminal region of Toscana Virus NSs protein is critical for interferon-? antagonism and protein stability.
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26397698 2015 Antitumorigenic effect of interferon-? by inhibition of undifferentiated glioblastoma cells.
26372645 2015 ADAP2 Is an Interferon Stimulated Gene That Restricts RNA Virus Entry.
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
More...