Property Summary

NCBI Gene PubMed Count 323
PubMed Score 6507.54
PubTator Score 2458.51

Knowledge Summary

Patent

No data available

Synonym

Accession P01574 Q5VWC9 IFN-beta
Symbols IFB
IFF
IFNB
IFN-beta

Gene

PDB

1AU1  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid

Gene RIF (307)

PMID Text
26819312 the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3
26609934 Together, the data demonstrate that interferon-beta inhibits foamy virus early in infection and that MxB is not a restriction factor of foamy virus.
26608320 These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production.
26602079 Data suggest microRNA-302c regulates interferon-beta production in innate/mucosal immunity partly via down-regulation of interferon regulatory factors IRF3/7; studies were conducted in lung epithelial cells infected with influenza A virus H3N2.
26474372 The C-terminal region of Toscana Virus NSs protein is critical for interferon-beta antagonism and protein stability.
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26397698 IFN-b could be an effective agent not only through its cell growth inhibitory effect on GSCs but also as a means of targeting the interconversion between GSCs and non-GSCs.
26372645 Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis.
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
More...

AA Sequence

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ      1 - 70
FQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS     71 - 140
LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN                           141 - 187
//

Text Mined References (325)

PMID Year Title
26819312 2016 Suppression of Type I Interferon Production by Human T-Cell Leukemia Virus Type 1 Oncoprotein Tax through Inhibition of IRF3 Phosphorylation.
26609934 2016 Interferon but not MxB inhibits foamy retroviruses.
26608320 2015 PACT- and RIG-I-Dependent Activation of Type I Interferon Production by a Defective Interfering RNA Derived from Measles Virus Vaccine.
26602079 2015 Mir-302c mediates influenza A virus-induced IFN? expression by targeting NF-?B inducing kinase.
26474372 2015 Truncation of the C-terminal region of Toscana Virus NSs protein is critical for interferon-? antagonism and protein stability.
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26397698 2015 Antitumorigenic effect of interferon-? by inhibition of undifferentiated glioblastoma cells.
26372645 2015 ADAP2 Is an Interferon Stimulated Gene That Restricts RNA Virus Entry.
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
More...