Property Summary

NCBI Gene PubMed Count 32
Grant Count 55
R01 Count 39
Funding $17,686,243.97
PubMed Score 641.85
PubTator Score 294.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (11)

PMID Text
25037218 Data indicate that haptoglobin-related protein (Hpr) is presented at the surface of hepG2 cells.
22433445 Our analysis illustrates the complex interplay between functions and haplotypes of adjacent genes, environmental context and natural selection, and offers insights into potential use of haptoglobin or haptoglobin-related protein as therapeutic agents.
20805508 show that trypanosome lytic factor-1 resistance in Trypanosoma brucei brucei is caused by reduced expression of the Hp/Hb receptor gene.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19324878 at low pH. Trypanosome lytic factor, apoL-1, and apoA-1 exhibit specificity for anionic membranes, whereas Hpr permeabilizes both anionic and zwitterionic membranes.
17845074 Infection by Trypanosoma brucei brucei causes hemolysis that triggers activation of trypanosome lytic factor by formation of haptoglobin-related protein-hemoglobin complexes, enhancing binding, trypanolytic activity, and clearance of parasites.
17360487 apoL-I is responsible for the trypanolytic activity of normal human serum, whereas Hpr allows fast uptake of the carrier HDL particles in trypanolysis
16778136 recombinant Hpr binds hemoglobin as efficiently as haptoglobin
More...

AA Sequence

MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN      1 - 70
DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL     71 - 140
TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP    141 - 210
SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT    211 - 280
FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN      281 - 348
//

Text Mined References (33)

PMID Year Title
25037218 2014 A retained secretory signal peptide mediates high density lipoprotein (HDL) assembly and function of haptoglobin-related protein.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22433445 2012 Complexity of a complex trait locus: HP, HPR, haemoglobin and cholesterol.
22403646 2012 A genome-wide association study identifies rs2000999 as a strong genetic determinant of circulating haptoglobin levels.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20805508 2010 Mechanism of Trypanosoma brucei gambiense (group 1) resistance to human trypanosome lytic factor.
More...