Property Summary

NCBI Gene PubMed Count 32
PubMed Score 641.85
PubTator Score 294.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.223 1.1e-05
medulloblastoma -1.500 1.8e-09
atypical teratoid/rhabdoid tumor -1.600 4.2e-10
medulloblastoma, large-cell -1.300 3.4e-03
primitive neuroectodermal tumor -1.100 1.6e-03
lung carcinoma -1.100 5.6e-09
mucosa-associated lymphoid tissue lympho... 1.196 4.8e-02

Gene RIF (11)

PMID Text
25037218 Data indicate that haptoglobin-related protein (Hpr) is presented at the surface of hepG2 cells.
22433445 Our analysis illustrates the complex interplay between functions and haplotypes of adjacent genes, environmental context and natural selection, and offers insights into potential use of haptoglobin or haptoglobin-related protein as therapeutic agents.
20805508 show that trypanosome lytic factor-1 resistance in Trypanosoma brucei brucei is caused by reduced expression of the Hp/Hb receptor gene.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19324878 at low pH. Trypanosome lytic factor, apoL-1, and apoA-1 exhibit specificity for anionic membranes, whereas Hpr permeabilizes both anionic and zwitterionic membranes.
17845074 Infection by Trypanosoma brucei brucei causes hemolysis that triggers activation of trypanosome lytic factor by formation of haptoglobin-related protein-hemoglobin complexes, enhancing binding, trypanolytic activity, and clearance of parasites.
17360487 apoL-I is responsible for the trypanolytic activity of normal human serum, whereas Hpr allows fast uptake of the carrier HDL particles in trypanolysis
16778136 recombinant Hpr binds hemoglobin as efficiently as haptoglobin
11814582 No trypanosome lytic activity in the sera of mice producing human haptoglobin-related protein

AA Sequence

MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN      1 - 70
DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL     71 - 140
TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP    141 - 210
SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT    211 - 280
FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN      281 - 348
//

Text Mined References (33)

PMID Year Title
25037218 2014 A retained secretory signal peptide mediates high density lipoprotein (HDL) assembly and function of haptoglobin-related protein.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22433445 2012 Complexity of a complex trait locus: HP, HPR, haemoglobin and cholesterol.
22403646 2012 A genome-wide association study identifies rs2000999 as a strong genetic determinant of circulating haptoglobin levels.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20805508 2010 Mechanism of Trypanosoma brucei gambiense (group 1) resistance to human trypanosome lytic factor.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19324878 2009 Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.
17845074 2007 Hemoglobin is a co-factor of human trypanosome lytic factor.
17360487 2007 Distinct roles of haptoglobin-related protein and apolipoprotein L-I in trypanolysis by human serum.
16778136 2006 Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16682745 2006 Isolation and characterization of human apolipoprotein M-containing lipoproteins.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11814582 2002 No trypanosome lytic activity in the sera of mice producing human haptoglobin-related protein.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10085035 1999 Characterization of a novel trypanosome lytic factor from human serum.
9461571 1998 Characterization of the human serum trypanosome toxin, haptoglobin-related protein.
8945641 1996 Transcriptionally active haptoglobin-related (Hpr) gene in hepatoma G2 and leukemia molt-4 cells.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7716520 1995 Killing of trypanosomes by the human haptoglobin-related protein.
4018023 1985 Structure and expression of the human haptoglobin locus.
2987228 1985 Nucleotide sequence of the haptoglobin and haptoglobin-related gene pair. The haptoglobin-related gene contains a retrovirus-like element.
2876426 1986 Polymorphisms in the human haptoglobin gene cluster: chromosomes with multiple haptoglobin-related (Hpr) genes.
1478675 1992 Junctions between genes in the haptoglobin gene cluster of primates.