Property Summary

NCBI Gene PubMed Count 37
PubMed Score 43.19
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 4.5e-06
osteosarcoma 1.326 4.6e-08
lung cancer 1.100 8.9e-03
subependymal giant cell astrocytoma -1.138 1.2e-02
Pick disease -1.100 2.2e-04
ovarian cancer 1.700 4.3e-06

Protein-protein Interaction (1)

Gene RIF (20)

PMID Text
26752685 substrate for hydroxylation by FIH on N22
26148240 the data suggest that OTUB1 limits the ubiquitination and degradation of FOXM1 in breast cancer and has a key role in genotoxic agent resistance.
25874870 HIV-1 Nef downregulates the expression of ubiquitin thioesterase (OTUB1) protein in Nef-transfected SupT1 cells
25872870 Data show that casein kinase 2 (CK2)-mediated phosphorylation of deubiquitylating enzyme OTUB1 at Ser16 causes nuclear accumulation of OTUB1.
25431208 OTUB1 promoted the metastasis of CRC cell lines.
24763515 After viral infection, HSCARG interacted with tumor necrosis receptor-associated factor 3 (TRAF3) and inhibited its ubiquitination by promoting the recruitment of OTUB1 to TRAF3.
24403071 These data reveal novel insights into the Otub1 inhibition of E2 wherein monoubiquitination promotes the interaction of Otub1 with UbcH5 and the function to suppress it.
24071738 OTUB1 enhances TGF-beta signaling by inhibiting the ubiquitylation and degradation of active SMAD2 and SMAD3.
23955022 A second role of OTUB1-E2 interactions is to stimulate OTUB1 cleavage of Lys48 polyubiquitin. This stimulation is regulated by the ratio of charged to uncharged E2 and by the concentration of Lys48-linked polyubiquitin and free ubiquitin.
23524849 These results suggest that OTUB1 regulates NF-kappaB and MAPK signalling pathways and TNF-dependent cell death by modulating c-IAP1 stability.
22679021 the crystal structure of human OTUB1 in complex with human UBC13 and MMS2
22367539 structural and biochemical studies elucidating how OTUB1 inhibits UBC13 and other E2 enzymes
22325355 OTUB1 therefore co-opts Lys48-linked ubiquitin chain recognition to suppress ubiquitin conjugation and the DNA damage response
22124327 Overexpression of Otub1(D88A) or ablation of endogenous Otub1 by siRNA markedly impaired p53 stabilization and activation in response to DNA damage. Together, these results reveal a novel function for Otub1 in regulating p53 stability and activity
20725033 OTUB1, a deubiquitinating enzyme, is an inhibitor of double-strand break-induced chromatin ubiquitination
20553488 Post-translational modifications of OTUB1 suggests a new entry point for manipulating Yersinia interactions with the host.
19996094 Findings suggest that OTUB1 and OTUB2 negatively regulate virus-triggered type I IFN induction and cellular antiviral response by deubiquitinating TRAF3 and -6.
19383985 OTUB1 negatively regulates transcription mediated by ERalpha in transient reporter gene assays and transcription mediated by endogenous ERalpha in Ishikawa endometrial cancer cells
19211026 Distinct binding sites for the ubiquitins on either side of the scissile bond allow hOtu1 to discriminate among different isopeptide linkages in polyubiquitin substrates.
18954305 Structural basis and specificity of human otubain 1-mediated deubiquitination.

AA Sequence

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ      1 - 70
KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN     71 - 140
TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP    141 - 210
MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK             211 - 271
//

Text Mined References (43)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26148240 2016 OTUB1 inhibits the ubiquitination and degradation of FOXM1 in breast cancer and epirubicin resistance.
25872870 2015 Casein kinase 2 (CK2) phosphorylates the deubiquitylase OTUB1 at Ser16 to trigger its nuclear localization.
25431208 2014 OTUB1 promotes metastasis and serves as a marker of poor prognosis in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24763515 2014 HSCARG negatively regulates the cellular antiviral RIG-I like receptor signaling pathway by inhibiting TRAF3 ubiquitination via recruiting OTUB1.
24403071 2014 Monoubiquitination is critical for ovarian tumor domain-containing ubiquitin aldehyde binding protein 1 (Otub1) to suppress UbcH5 enzyme and stabilize p53 protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24071738 2013 OTUB1 enhances TGF? signalling by inhibiting the ubiquitylation and degradation of active SMAD2/3.
23955022 2013 E2 ubiquitin-conjugating enzymes regulate the deubiquitinating activity of OTUB1.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23524849 2013 OTUB1 modulates c-IAP1 stability to regulate signalling pathways.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22679021 2012 Molecular basis of Lys-63-linked polyubiquitination inhibition by the interaction between human deubiquitinating enzyme OTUB1 and ubiquitin-conjugating enzyme UBC13.
22367539 2012 The mechanism of OTUB1-mediated inhibition of ubiquitination.
22325355 2012 OTUB1 co-opts Lys48-linked ubiquitin recognition to suppress E2 enzyme function.
22124327 2012 Positive regulation of p53 stability and activity by the deubiquitinating enzyme Otubain 1.
21269460 2011 Initial characterization of the human central proteome.
20725033 2010 Non-canonical inhibition of DNA damage-dependent ubiquitination by OTUB1.
20553488 2010 Post-translational modification of the deubiquitinating enzyme otubain 1 modulates active RhoA levels and susceptibility to Yersinia invasion.
19996094 2010 Regulation of virus-triggered signaling by OTUB1- and OTUB2-mediated deubiquitination of TRAF3 and TRAF6.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19383985 2009 OTU Domain-containing ubiquitin aldehyde-binding protein 1 (OTUB1) deubiquitinates estrogen receptor (ER) alpha and affects ERalpha transcriptional activity.
19211026 2009 Evidence for bidentate substrate binding as the basis for the K48 linkage specificity of otubain 1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18954305 2009 Structural basis and specificity of human otubain 1-mediated deubiquitination.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16364312 2006 Identification of otubain 1 as a novel substrate for the Yersinia protein kinase using chemical genetics and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661020 2004 Two isoforms of otubain 1 regulate T cell anergy via GRAIL.
12704427 2003 Otubains: a new family of cysteine proteases in the ubiquitin pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401499 2002 Chemistry-based functional proteomics reveals novel members of the deubiquitinating enzyme family.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10664582 2000 A novel superfamily of predicted cysteine proteases from eukaryotes, viruses and Chlamydia pneumoniae.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.