Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.09

Knowledge Summary

Patent (105)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9

AA Sequence

MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMYFSIRHLAFVD      1 - 70
LGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAYDRYVAICNPLLYYVIMSQRL     71 - 140
CHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCDDVPLLPMLCSNAQEIELLSILFSVFNLISS    141 - 210
FLIVLVSYMLILLAICQMHSAEGRKKAFSTCGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTL    211 - 280
VIPMLNPLIYSLRNEEVKNAFYKLFEN                                               281 - 307
//

Text Mined References (1)

PMID Year Title