Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.35

Knowledge Summary

Patent (148)


  Disease (1)

Disease Target Count Z-score Confidence
Oropharynx cancer 9 3.968 2.0


AA Sequence

NLYLLLPPTMNPIVYGVKTKQIQEGVIKFLLGDKVSFTYDK                                 281 - 321

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.