Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.54
PubTator Score 0.78

Knowledge Summary

Patent (89)

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1663 1.4e-03
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Malaria 140 0.0 2.0
Peripheral vascular disease 90 0.0 2.0
Disease Target Count Z-score Confidence
Thalassemia 46 3.691 1.8

AA Sequence

MFLSSRMITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLGNCMVLHVIWTEPSLHQPMFY      1 - 70
FLSMLALTDLCMGLSTVYTVLGILWGIIREISLDSCIAQSYFIHGLSFMESSVLLTMAFDRYIAICNPLR     71 - 140
YSSILTNSRIIKIGLTIIGRSFFFITPPIICLKFFNYCHFHILSHSFCLHQDLLRLACSDIRFNSYYALM    141 - 210
LVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHICAVLVFYIPIISLTMVHRFGKHLSPV    211 - 280
AHVLIGNIYILFPPLMNPIIYSVKTQQIHTRMLRLFSLKRY                                 281 - 321
//

Text Mined References (3)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.