Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.19
PubTator Score 0.55

Knowledge Summary

Patent (260)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.8e-09
medulloblastoma, large-cell 6241 1.9e-04
diabetes mellitus 1728 1.0e-03
psoriasis 6694 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Sickle Cell Anemia 53 3.105 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.300 1.0e-03
medulloblastoma, large-cell 1.300 1.9e-04
ovarian cancer 1.100 5.8e-09
psoriasis -1.100 4.8e-02

AA Sequence

MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYFLAMLADTDLG      1 - 70
MTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCFIAIRTPLRYNCILTNSRVMN     71 - 140
IGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQDVIKLACADITFNHIYPIIQTSLTVFLDALI    141 - 210
IIFSYILILKTVMGIASGQEEAKSLNTCVSHISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLF    211 - 280
PPFVNPIIYSIKTKQIQRSIIRLFSGQSRA                                            281 - 310
//

Text Mined References (5)

PMID Year Title