Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.18
PubTator Score 0.50

Knowledge Summary

Patent (201)

AA Sequence

MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVT      1 - 70
APKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAV     71 - 140
AWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIIS    141 - 210
YTIILMTIQHRPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIY    211 - 280
TLRNKDMKTAIRQLRKWDAHSSVKF                                                 281 - 305
//

Text Mined References (5)

PMID Year Title