Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.05
PubTator Score 97.82

Knowledge Summary

Patent (430)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.4e-03

Gene RIF (2)

17579849 This work shows the feasibility of an olfactory biosensor based on the immobilization of Saccharomyces cerevisiae yeast cells genetically modified to express the human olfactory receptor OR17-40
16980412 This unique mechanism of continuous internalization and recycling of OR17-40 might be instrumental in allowing rapid recovery of odor perception.

AA Sequence

NTVINPMLNPIIYSFRNPDVQSAIWRMLTGRRSLA                                       281 - 315

Text Mined References (11)

PMID Year Title
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
17579849 2007 A new concept of olfactory biosensor based on interdigitated microelectrodes and immobilized yeasts expressing the human receptor OR17-40.
16980412 2006 Visualizing odorant receptor trafficking in living cells down to the single-molecule level.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
8921386 1996 Sequence analysis in the olfactory receptor gene cluster on human chromosome 17: recombinatorial events affecting receptor diversity.
8647456 1996 Olfactory receptor-encoding genes and pseudogenes are expressed in humans.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.