Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.25
PubTator Score 4.08

Knowledge Summary

Patent (259)

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 1.8e-09
osteosarcoma 7950 2.2e-05
diabetes mellitus 1728 2.4e-03
group 3 medulloblastoma 4104 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.300 2.4e-03
ependymoma -1.100 1.8e-09
group 3 medulloblastoma 1.500 2.9e-02
osteosarcoma -3.543 2.2e-05

Gene RIF (6)

AA Sequence

MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMYFFLAHLSFLD      1 - 70
LSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAYDRCVAICKPLHYMVIMNPRL     71 - 140
CRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLREMPALIRMACVSTVAIEGTVFVLAVGVVLSP    141 - 210
LVFILLSYSYIVRAVLQIRSASGRQKAFGTCGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNI    211 - 280
VTPLLNPLIYTLRNREVKGALGRLLLGKRELGKE                                        281 - 314
//

Text Mined References (12)

PMID Year Title