Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 45.81

Knowledge Summary

Patent (110)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Irritant 9 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Irritant dermatitis 9 4.208 2.1

Gene RIF (1)

AA Sequence

MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMYFFLTNLSILD      1 - 70
LCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSFDRYVAVCRPLHYVVIMNYWF     71 - 140
CLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIEAELFFFSVLILLIP    141 - 210
VTLILISYGFIAQAVLKIRSAEGRQKAFGTCGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGI    211 - 280
ITSMLNSLIYSLRNKDMKEAFKRLMPRIFFCKK                                         281 - 313
//

Text Mined References (8)

PMID Year Title