Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00

Knowledge Summary

Patent (161)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.2e-09
ovarian cancer 8520 9.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MEPEKQTEISEFFLQGLSEKPEHQTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMYFFLFNLSLVD      1 - 70
TLLSSTTVPKMLANIQAQSRAIPFVGCLTQMYAFHLFGTMDSFLLAVMAIDRFVAIVHPQRYLVLMCSPV     71 - 140
CGLLLGASWMITNLQSLIHTCLMAQLTFCAGSEISHFFCDLMPLLKLSGSDTHTNELVIFAFGIVVGTSP    141 - 210
FSCILLSYIRIFWTVFKIPSTRGKWKAFSTCGLHLTVVSLSYGTIFAVYLQPTSPSSSQKDKAAALMCGV    211 - 280
FIPMLNPFIYSIRNKDMKAALGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAG    281 - 350
NRDME                                                                     351 - 355
//

Text Mined References (3)

PMID Year Title