Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple Sclerosis 498 1.4e-04
diabetes mellitus 1663 3.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.700 3.6e-03
Multiple Sclerosis 3.100 1.4e-04

AA Sequence

MERDKPVSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILAISIDSRLHTPMYFFLSNMSFVD      1 - 70
NCFSTTVPKMLANHILRTQTISFSGCLMQMYFISELADMDNFLLAVMAYDRFVAVCRPLHYTAKMIHQLC     71 - 140
ALLVTGSWVVANSNALLHTLLMARLSFCADNTIPHIFCDVTPLLKLSCSDTHLSEVMILTEAALVTITPF    141 - 210
LCLLASYMHITCVVLRVPSTKGRWKAFSTCGSHLAVVLLFYGTIMSPYFRTSSSHSAQRDIAAAVRFTVV    211 - 280
TPVMNPLIYSLRNKDIKGALVKVVAVKFFSVQ                                          281 - 312
//

Text Mined References (4)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9653642 1998 A transcriptional Map of the FMF region.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.