Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (52)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.6e-06

AA Sequence

MEVKNCCMVTEFILLGIPHTEGLEMTLFVLFLPFYACTLLGNVSILVAVMSSARLHTPMYFFLGNLSVFD      1 - 70
MGFSSVTCPKMLLYLMGLSRLISYKDCVCQLFFFHFLGSIECFLFTVMAYDRFTAICYPLRYTVIMNPRI     71 - 140
CVALAVGTWLLGCIHSSILTSLTFTLPYCGPNEVDHFFCDIPALLPLACADTSLAQRVSFTNVGLISLVC    141 - 210
FLLILLSYTRITISILSIRTTEGRRRAFSTCSAHLIAILCAYGPIITVYLQPTPNPMLGTVVQILMNLVG    211 - 280
PMLNPLIYTLRNKEVKTALKTILHRTGHVPES                                          281 - 312
//

Text Mined References (2)

PMID Year Title