Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.23
PubTator Score 1.36

Knowledge Summary

Patent (3,375)


  Disease (1)

AA Sequence

VVTPMLNPIIYSLRNSEVKNALSRTFHKVLALRNCIP                                     281 - 317

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.
11416212 2001 Genomic analysis of orthologous mouse and human olfactory receptor loci.
9787077 1998 Organization and evolution of olfactory receptor genes on human chromosome 11.