Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.71
PubTator Score 1.86

Knowledge Summary

Patent (10,646)

AA Sequence

VVTPMLNPIIYSSRNKEVKAALKRLIHRTLGSQKL                                       281 - 315

Text Mined References (7)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.
11416212 2001 Genomic analysis of orthologous mouse and human olfactory receptor loci.