Property Summary

NCBI Gene PubMed Count 41
PubMed Score 557.52
PubTator Score 292.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
psoriasis -2.100 3.6e-07
astrocytoma -1.100 9.2e-06
oligodendroglioma -1.300 8.9e-07
osteosarcoma 3.585 4.0e-02
Duchenne muscular dystrophy 2.296 2.5e-07
autosomal dominant Emery-Dreifuss muscul... 2.161 3.3e-03
juvenile dermatomyositis 1.534 3.7e-07
limb girdle muscular dystrophy 2A 1.265 9.9e-03
Atopic dermatitis -3.000 3.4e-05
adrenocortical carcinoma -3.919 3.1e-15
primary pancreatic ductal adenocarcinoma 1.164 3.7e-02
non-small cell lung cancer -3.207 1.2e-19
intraductal papillary-mucinous adenoma (... -5.400 4.2e-05
intraductal papillary-mucinous carcinoma... -5.800 2.9e-05
intraductal papillary-mucinous neoplasm ... -6.000 7.3e-04
colon cancer -2.100 1.0e-03
lung cancer -2.300 4.2e-05
pancreatic cancer 1.400 2.6e-02
breast carcinoma -2.600 1.3e-29
fibroadenoma -1.300 2.5e-02
diabetes mellitus -1.500 1.4e-02
lung adenocarcinoma -2.100 2.3e-10
posterior fossa group B ependymoma 2.400 3.5e-06
sonic hedgehog group medulloblastoma 2.200 1.3e-02
primary Sjogren syndrome 1.300 1.5e-03
inflammatory breast cancer -1.700 3.6e-04
invasive ductal carcinoma -4.500 6.7e-04
lung carcinoma -2.500 8.1e-12
ductal carcinoma in situ -1.800 4.2e-02
ovarian cancer -7.300 1.3e-19

 GO Function (1)

 CSPA Cell Line (1)

Gene RIF (17)

PMID Text
26870797 mimecan is a satiety hormone in adipose tissue, and that mimecan inhibits food intake independently of leptin signaling by inducing IL-1beta and IL-6 expression in the hypothalamus.
26206738 Increased plasma mimecan levels are independently associated with increased arterial stiffness in hypertensive patients.
26045825 OIF may be an indicator of the earlier-stage diabetic nephropathy in subjects with type 2 diabetes mellitus
25953442 OGN might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25463067 The lack of the proteoglycan OGN does not affect the progression of atherosclerosis in mice. Possible causes for the absence of phenotype in the Apoe/Ogn double mutants are discussed.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
24651681 Circulating OGN and NGAL/MMP9 complex are promising biomarkers that are expressed in vulnerable atherosclerotic plaques and may have incremental value for prediction of MACE within 1 year after coronary angiography.
23714241 We found that IGF-2 and IGFBP2 synergistically increased neurite outgrowth via enhanced early signaling through the IGF type 1 receptor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360993 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18243607 High expression in the cochlea may be suggestive of a fundamental role for a transcript in the auditory system
17895523 All adenoma and cancer tissues did not express mimecan, but all normal mucosa did (P < 0.01).
16189248 This work provides insight into the regulating mechanism of mimecan in pituitary and suggests that mimecan may be an unidentified pituitary secretory protein, and certain pituitary cells secreting ACTH or GH also secrete mimecan.
10373482 Includes the characterization of two human splice variants.

AA Sequence

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS      1 - 70
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA     71 - 140
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK    141 - 210
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG    211 - 280
KHPNSFICLKRLPIGSYF                                                        281 - 298
//

Text Mined References (46)

PMID Year Title
26870797 2015 Mimecan, a Hormone Abundantly Expressed in Adipose Tissue, Reduced Food Intake Independently of Leptin Signaling.
26206738 2015 Serum Mimecan Is Associated With Arterial Stiffness in Hypertensive Patients.
26170933 2015 Overexpression of mimecan in human aortic smooth muscle cells inhibits cell proliferation and enhances apoptosis and migration.
26045825 2015 Osteoinductive factor is a novel biomarker for the diagnosis of early diabetic nephropathy.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25463067 2014 Osteoglycin deficiency does not affect atherosclerosis in mice.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24651681 2014 Circulating osteoglycin and NGAL/MMP9 complex concentrations predict 1-year major adverse cardiovascular events after coronary angiography.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23714241 2013 Enhancement of IGF-2-induced neurite outgrowth by IGF-binding protein-2 and osteoglycin in SH-SY5Y human neuroblastoma cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360993 2010 Candidate gene study to investigate the genetic determinants of normal variation in central corneal thickness.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18243607 2008 Expression studies of osteoglycin/mimecan (OGN) in the cochlea and auditory phenotype of Ogn-deficient mice.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895523 2007 Differential expression of mimecan and thioredoxin domain-containing protein 5 in colorectal adenoma and cancer: a proteomic study.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189248 2005 The mimecan gene expressed in human pituitary and regulated by pituitary transcription factor-1 as a marker for diagnosing pituitary tumors.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15164053 2004 DNA sequence and analysis of human chromosome 9.
13679028 2003 Cloning, characterization, and mRNA expression analysis of novel human fetal cochlear cDNAs.
12533723 2003 The UV responsive elements in the human mimecan promoter: a functional characterization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10828622 2000 Assignment of mimecan gene (OGN) to human chromosome band 9q22 by in situ hybridization.
10802664 2000 Mutations in KERA, encoding keratocan, cause cornea plana.
10656267 2000 Super-motifs and evolution of tandem leucine-rich repeats within the small proteoglycans--biglycan, decorin, lumican, fibromodulin, PRELP, keratocan, osteoadherin, epiphycan, and osteoglycin.
10373482 1999 The bovine mimecan gene. Molecular cloning and characterization of two major RNA transcripts generated by alternative use of two splice acceptor sites in the third exon.
9346963 1997 Mimecan, the 25-kDa corneal keratan sulfate proteoglycan, is a product of the gene producing osteoglycin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2372374 1990 Molecular cloning of a novel bone-forming compound: osteoinductive factor.
2326263 1990 Osteoinductive factor inhibits formation of human osteoclast-like cells.