Property Summary

NCBI Gene PubMed Count 23
PubMed Score 207.62
PubTator Score 29.09

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGA      1 - 70
ISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVS     71 - 140
SAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS                          141 - 188
//

Text Mined References (30)

PMID Year Title