Property Summary

NCBI Gene PubMed Count 20
PubMed Score 120.88
PubTator Score 29.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -2.198 2.9e-06
astrocytoma 2.000 1.8e-03
group 3 medulloblastoma 1.300 3.4e-02
osteosarcoma 2.097 1.1e-04
ovarian cancer 1.600 1.6e-04

Synonym

Accession O96006 Q96BY4
Symbols ALTE
DREF
TRAMP
hDREF

Gene

PDB

2CT5  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKN      1 - 70
HPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYP     71 - 140
ASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAY    141 - 210
VTLAAHFLGLGAPNCLSMGSRCLKTFEVPEENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACS    211 - 280
LLDVAVHMPCLGHTFNAGIQQAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNR    281 - 350
VSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS    351 - 420
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPFLSAFER    421 - 490
QQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVED    491 - 560
QEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVS    561 - 630
AKRNRLAPAHVDEQVFLYENARSGAEAEPEDQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL          631 - 694
//

Text Mined References (23)

PMID Year Title