Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.94
PubTator Score 5.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Pancreatic Neoplasms 85 0.0 0.0
Disease Target Count
Pancreatic Neoplasm 85
Disease Target Count P-value
lung cancer 4740 7.3e-04
ependymoma 4679 1.2e-03
oligodendroglioma 2850 2.0e-03
psoriasis 6694 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 2.1
Vascular disease 319 0.0 0.9
Disease Target Count Z-score Confidence
Cleft Lip 141 4.438 2.2
Cleft Palate 271 3.808 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.400 1.2e-03
lung cancer 1.200 7.3e-04
oligodendroglioma 1.100 2.0e-03
psoriasis 1.200 3.1e-03

Gene RIF (12)

AA Sequence

MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAIS      1 - 70
SWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGE     71 - 140
NSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKN    141 - 210
LLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIY    211 - 280
FNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALL    281 - 350
ETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQ    351 - 420
VSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCY    421 - 490
AVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFV    491 - 560
IKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGEDPTAAAPVAEVPTAAGALTPTPAPTTT    561 - 630
TATREEASTSLPTKPTQGASSASEPQEAPPKPAEDKKKD                                   631 - 669
//

Text Mined References (31)

PMID Year Title