Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
R01 Count 2
Funding $554,433
PubMed Score 15.05
PubTator Score 13.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession O95995 B2RCT1 B7Z4U1 G3V1L5 Q2M234 GAS-8
Symbols DRC4
GAS11
CILD33

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
26387594 Loss-of-Function GAS8 Mutations Cause Primary Ciliary Dyskinesia and Disrupt the Nexin-Dynein Regulatory Complex.
19995461 A two-hybrid screen for proteins that interact with NS1 from influenza A yielded growth arrest-specific protein 8. Gas8 associated with NS1 in vitro and in vivo.

AA Sequence

MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQL      1 - 70
EEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRK     71 - 140
DMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHE    141 - 210
VEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLA    211 - 280
DPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFT    281 - 350
AAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDL    351 - 420
QYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT                421 - 478
//

Publication (15)

PMID Year Title
27472056 2016 Mutation of Growth Arrest Specific 8 Reveals a Role in Motile Cilia Function and Human Disease.
26387594 2015 Loss-of-Function GAS8 Mutations Cause Primary Ciliary Dyskinesia and Disrupt the Nexin-Dynein Regulatory Complex.
19995461 2009 Interaction of influenza virus NS1 protein with growth arrest-specific protein 8.
19340012 2009 Genome-wide association study of tanning phenotype in a population of European ancestry.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17009870 2006 Trypanin, a component of the flagellar Dynein regulatory complex, is essential in bloodstream form African trypanosomes.
16643277 2006 Expanding the role of the dynein regulatory complex to non-axonemal functions: association of GAS11 with the Golgi apparatus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...