Property Summary

NCBI Gene PubMed Count 120
Grant Count 10
R01 Count 4
Funding $596,975
PubMed Score 185.25
PubTator Score 176.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (112)

PMID Text
26459448 RECK is a regulator of hMSC functions suggesting that modulation of RECK may improve the development of hMSC-based therapeutical approaches in regenerative medicine.
26449734 RECK is not an independent prognostic marker for breast cancer
26431549 Findings suggest that RECK transcript variants might have opposite roles in GBM biology and the ratio of their expression levels may be informative for the prognostic outcome of GBM patients.
26364844 miR-221/miR-222-RECK axis might be an important path modulating H. pylori infection-related gastric cancer development
26284486 miR-21 has a role in upregulating PTEN, RECK and PDCD4 in glioma
26261088 MMP-9/RECK imbalance in cervical smears is significantly associated with high-grade cervical diseases and infection by alpha-9 HPV and C. trachomatis.
26141647 present data indicate that there is a significant association between mutant G of rs11788747 in RECK and WT risk
26130413 This downregulation of RECK in advanced grades of osteosarcoma and metastatic grades was also associated with the increased expression of invadosome-specific markers like MMP9
26026961 A decrease in SPRY2 and RECK expression by nickel-induced miR-21 may promote invasiveness in lung cancer cells.
26026078 These findings suggest that immunohistochemical staining for RECK could be useful in the differential diagnosis between CMM and BMN.
More...

AA Sequence

MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRA      1 - 70
PDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFS     71 - 140
CISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP    141 - 210
TDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPP    211 - 280
PSTGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGC    281 - 350
RNLTYCTNFNNRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK    351 - 420
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEV    421 - 490
THPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSC    491 - 560
GQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNVCSCFAGNLVCSTRLCLSEHSSEDDRRTFTG    561 - 630
LPCNCADQFVPVCGQNGRTYPSACIARCVGLQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFD    631 - 700
KFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSS    701 - 770
VCAAYSDRVAVDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK    771 - 840
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIEACNKEAEKIE    841 - 910
SLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSLGLALHLLWTYN             911 - 971
//

Text Mined References (121)

PMID Year Title
26459448 2016 RECK (reversion-inducing cysteine-rich protein with Kazal motifs) regulates migration, differentiation and Wnt/?-catenin signaling in human mesenchymal stem cells.
26449734 2015 RECK is not an independent prognostic marker for breast cancer.
26431549 2015 Isolation and characterization of novel RECK tumor suppressor gene splice variants.
26364844 2015 miR-221 and miR-222 Simultaneously Target RECK and Regulate Growth and Invasion of Gastric Cancer Cells.
26284486 2015 Exosomal levels of miRNA-21 from cerebrospinal fluids associated with poor prognosis and tumor recurrence of glioma patients.
26261088 2015 MMP-9/RECK Imbalance: A Mechanism Associated with High-Grade Cervical Lesions and Genital Infection by Human Papillomavirus and Chlamydia trachomatis.
26141647 2015 RECK Gene Polymorphism is Associated with Susceptibility and Prognosis of Wilms' Tumor in Chinese Children.
26130413 2015 Promoter hypermethylation of the cysteine protease RECK may cause metastasis of osteosarcoma.
26026961 2015 Nickel may contribute to EGFR mutation and synergistically promotes tumor invasion in EGFR-mutated lung cancer via nickel-induced microRNA-21 expression.
26026078 2015 Reduced Expression of RECK Protein May Help Differentiate Cutaneous Malignant Melanoma from Melanocytic Nevus.
More...