Property Summary

NCBI Gene PubMed Count 127
PubMed Score 194.41
PubTator Score 176.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Atopic dermatitis -2.200 2.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.225 1.1e-02
Breast cancer -1.300 6.2e-05
breast carcinoma -1.200 1.8e-03
ductal carcinoma in situ -1.600 2.0e-03
head and neck cancer -1.500 4.8e-02
intraductal papillary-mucinous adenoma (... -2.900 1.9e-03
intraductal papillary-mucinous carcinoma... -3.600 8.4e-04
intraductal papillary-mucinous neoplasm ... -3.500 8.2e-03
invasive ductal carcinoma -2.500 7.2e-04
lung adenocarcinoma -1.200 4.2e-11
lung cancer -2.200 5.4e-05
lung carcinoma -1.100 5.7e-09
malignant mesothelioma -1.300 4.9e-06
medulloblastoma, large-cell -1.300 4.6e-02
non-small cell lung cancer -1.956 4.9e-19
ovarian cancer -4.500 6.1e-14
psoriasis -1.700 2.0e-05

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (119)

AA Sequence

MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRA      1 - 70
PDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFS     71 - 140
CISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP    141 - 210
TDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPP    211 - 280
PSTGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGC    281 - 350
RNLTYCTNFNNRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK    351 - 420
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEV    421 - 490
THPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSC    491 - 560
GQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNVCSCFAGNLVCSTRLCLSEHSSEDDRRTFTG    561 - 630
LPCNCADQFVPVCGQNGRTYPSACIARCVGLQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFD    631 - 700
KFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSS    701 - 770
VCAAYSDRVAVDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK    771 - 840
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIEACNKEAEKIE    841 - 910
SLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSLGLALHLLWTYN             911 - 971
//

Text Mined References (128)

PMID Year Title