Property Summary

NCBI Gene PubMed Count 12
Grant Count 14
R01 Count 1
Funding $1,870,101.49
PubMed Score 15.88
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma -1.500 0.000
oligodendroglioma -1.100 0.000
ependymoma -1.900 0.000
medulloblastoma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
breast carcinoma 1.600 0.017
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.800 0.000

Gene RIF (7)

PMID Text
23414653 several rare variants of the DLGAP3 gene were found in this study which may be associated with schizophrenia.
21990008 This study provides suggestive evidence that DLGAP3 and its interactive effect with SLC1A1 might be involved in susceptibility to developing OC symptoms in schizophrenia patients receiving AAP treatment.
21295225 This study generated preliminary evidence to link SAPAP3 variants to the development of earlier onset obsessive-compulsive disorder.
21184590 DLGAP3 remains a promising candidate gene for Tourette Syndrome.
19096451 Multiple rare SAPAP3 missense variants in trichotillomania and OCD.
19051237 Sapap3 is a promising functional candidate gene for human grooming disorder (obsessive compulsive disorder).
19051237 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRGYHGDRGSHPRPARFADQQHMDVGPAARAPYLLGSREAFSTEPRFCAPRAGLGHISPEGPLSLSEGPS      1 - 70
VGPEGGPAGAGVGGGSSTFPRMYPGQGPFDTCEDCVGHPQGKGAPRLPPTLLDQFEKQLPVQQDGFHTLP     71 - 140
YQRGPAGAGPGPAPGTGTAPEPRSESPSRIRHLVHSVQKLFAKSHSLEAPGKRDYNGPKAEGRGGSGGDS    141 - 210
YPGPGSGGPHTSHHHHHHHHHHHHQSRHGKRSKSKDRKGDGRHQAKSTGWWSSDDNLDSDSGFLAGGRPP    211 - 280
GEPGGPFCLEGPDGSYRDLSFKGRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMVSQGRDGYPGAGPG    281 - 350
KGLLGPETKAKARTYHYLQVPQDDWGGYPTGGKDGEIPCRRMRSGSYIKAMGDEESGDSDGSPKTSPKAV    351 - 420
ARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELESQAVDAL    421 - 490
DLPGCFRMRSHSYLRAIQAGCSQDDDCLPLLATPAAVSGRPGSSFNFRKAPPPIPPGSQAPPRISITAQS    491 - 560
STDSAHESFTAAEGPARRCSSADGLDGPAMGARTLELAPVPPRASPKPPTLIIKTIPGREELRSLARQRK    561 - 630
WRPSIGVQVETISDSDTENRSRREFHSIGVQVEEDKRRARFKRSNSVTAGVQADLELEGLAGLATVATED    631 - 700
KALQFGRSFQRHASEPQPGPRAPTYSVFRTVHTQGQWAYREGYPLPYEPPATDGSPGPAPAPTPGPGAGR    701 - 770
RDSWIERGSRSLPDSGRASPCPRDGEWFIKMLRAEVEKLEHWCQQMEREAEDYELPEEILEKIRSAVGST    771 - 840
QLLLSQKVQQFFRLCQQSMDPTAFPVPTFQDLAGFWDLLQLSIEDVTLKFLELQQLKANSWKLLEPKEEK    841 - 910
KVPPPIPKKPLRGRGVPVKERSLDSVDRQRQEARKRLLAAKRAASFRHSSATESADSIEIYIPEAQTRL     911 - 979
//

Text Mined References (13)

PMID Year Title
23414653 2013 Exonic resequencing of the DLGAP3 gene as a candidate gene for schizophrenia.
22761992 2012 Synthesis of two SAPAP3 isoforms from a single mRNA is mediated via alternative translational initiation.
21990008 2011 Interaction between genetic variants of DLGAP3 and SLC1A1 affecting the risk of atypical antipsychotics-induced obsessive-compulsive symptoms.
21295225 Investigating SAPAP3 variants in the etiology of obsessive-compulsive disorder and trichotillomania in the South African white population.
21184590 2011 Family-based genetic association study of DLGAP3 in Tourette Syndrome.
19096451 2009 Multiple rare SAPAP3 missense variants in trichotillomania and OCD.
19051237 2009 Sapap3 and pathological grooming in humans: Results from the OCD collaborative genetics study.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16202977 2005 FAK and PYK2 interact with SAP90/PSD-95-Associated Protein-3.
More...