Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.98
PubTator Score 40.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 3.6e-03
osteosarcoma 1.020 1.8e-03
ovarian cancer 1.500 1.2e-03

Synonym

Accession O95872 A6NG25 B0UXA2 Q5SQ49
Symbols G5
BAT4
D6S54E
ANKRD59
GPATCH10

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Protein-protein Interaction (6)

Gene RIF (6)

AA Sequence

MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRSQTEPARERKR      1 - 70
KKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARD     71 - 140
AFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRS    141 - 210
PTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEG    211 - 280
RANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT    281 - 350
YMNLEF                                                                    351 - 356
//

Text Mined References (23)

PMID Year Title