Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 3.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 4.87601078537222E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.26596006768048E-5
primary pancreatic ductal adenocarcinoma 1271 1.79594801908927E-4
pituitary cancer 1972 4.54011502724588E-4
pancreatic cancer 2300 0.00155008221069738
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00186117105137183
gastric carcinoma 832 0.00593013194422646
Disease Target Count Z-score Confidence
Cone dystrophy 59 4.444 2.2

Synonym

Accession O95843 O95844 Q9UNM0 GCAP 3
Symbols GCAP3

Gene

PDB

2GGZ  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
16626734 Results report the crystal structure of unmyristoylated human guanylate cyclase-activating protein 3 (GCAP3) with calcium bound.

AA Sequence

MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDG      1 - 70
FVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFH     71 - 140
KIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK     141 - 209
//

Text Mined References (5)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16626734 2006 The crystal structure of GCAP3 suggests molecular mechanism of GCAP-linked cone dystrophies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11860507 2002 Characterization of retinal guanylate cyclase-activating protein 3 (GCAP3) from zebrafish to man.
10037746 1999 Molecular characterization of a third member of the guanylyl cyclase-activating protein subfamily.