Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDG      1 - 70
FVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFH     71 - 140
KIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK     141 - 209
//

Text Mined References (5)

PMID Year Title