Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Synonym

Accession O95843 O95844 Q9UNM0 GCAP 3
Symbols GCAP3

Gene

PDB

2GGZ  

Gene RIF (1)

PMID Text
16626734 Results report the crystal structure of unmyristoylated human guanylate cyclase-activating protein 3 (GCAP3) with calcium bound.

AA Sequence

MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDG      1 - 70
FVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFH     71 - 140
KIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK     141 - 209
//

Text Mined References (5)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16626734 2006 The crystal structure of GCAP3 suggests molecular mechanism of GCAP-linked cone dystrophies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11860507 2002 Characterization of retinal guanylate cyclase-activating protein 3 (GCAP3) from zebrafish to man.
10037746 1999 Molecular characterization of a third member of the guanylyl cyclase-activating protein subfamily.