Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 7
Funding $856,030.76
PubMed Score 19.34
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.664 0.001
astrocytoma -1.100 0.036
glioblastoma -1.600 0.001
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.700 0.000
ovarian cancer -2.200 0.000

Gene RIF (1)

PMID Text
17497241 Data show that human and yeast zeta-crystallins bind AU-rich elements in RNA.

AA Sequence

MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV      1 - 70
LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS     71 - 140
HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL    141 - 210
EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA    211 - 280
TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF     281 - 349
//

Text Mined References (11)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
21269460 2011 Initial characterization of the human central proteome.
17497241 2007 Human and yeast zeta-crystallins bind AU-rich elements in RNA.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10986039 2000 Genomic sequence, splicing, and gene annotation.
10830953 2000 The DNA sequence of human chromosome 21.
More...