Property Summary

NCBI Gene PubMed Count 10
PubMed Score 20.51
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.700 3.3e-04
astrocytoma -1.100 3.6e-02
glioblastoma -1.600 1.1e-03
medulloblastoma, large-cell -1.300 1.6e-04
osteosarcoma 1.344 8.9e-04
ovarian cancer -2.200 6.0e-15

Gene RIF (1)

AA Sequence

MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV      1 - 70
LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS     71 - 140
HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL    141 - 210
EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA    211 - 280
TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF     281 - 349
//

Text Mined References (11)

PMID Year Title