Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.34
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.664 0.001
astrocytoma -1.100 0.036
glioblastoma -1.600 0.001
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.700 0.000
ovarian cancer -2.200 0.000

Synonym

Accession O95825 B2RDX1 B3KQ77 Q96DY0 Q9NVY7
Symbols 4P11
QOH-1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (1)

PMID Text
17497241 Data show that human and yeast zeta-crystallins bind AU-rich elements in RNA.

AA Sequence

MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV      1 - 70
LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS     71 - 140
HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL    141 - 210
EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA    211 - 280
TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF     281 - 349
//

Text Mined References (11)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
21269460 2011 Initial characterization of the human central proteome.
17497241 2007 Human and yeast zeta-crystallins bind AU-rich elements in RNA.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10986039 2000 Genomic sequence, splicing, and gene annotation.
10830953 2000 The DNA sequence of human chromosome 21.
More...