Property Summary

NCBI Gene PubMed Count 28
Grant Count 16
R01 Count 15
Funding $766,346.58
PubMed Score 101.06
PubTator Score 53.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma -1.200 0.019
osteosarcoma 2.885 0.000
ependymoma 1.200 0.000
hereditary spastic paraplegia -1.226 0.012
Atopic dermatitis -1.400 0.001
lung cancer 2.400 0.001
colon cancer -1.300 0.035
active Crohn's disease 2.686 0.011
Breast cancer 2.600 0.026
cystic fibrosis 1.800 0.000
aldosterone-producing adenoma -1.450 0.024
psoriasis -1.100 0.000
ulcerative colitis 2.200 0.000
ovarian cancer -1.600 0.000

Gene RIF (8)

PMID Text
26271008 Thus, BAG2 promotes mutant p53 accumulation and gain-of-function in tumor growth, metastasis and chemoresistance.
25985852 NF-kappaB-mediated modulation of BAG2 expression regulates the shift between the neurotrophic and neurotoxic effects of Abeta1-42.
25006867 This study showed that BAG2 (Bcl-2 associated athanogene family protein 2) and BAG5 (Bcl-2-associated athanogene family protein 5) stabilise pathogenic ataxin3-80Q by inhibiting its ubiquitination
24383081 this data correlate BAG2 to PINK1 for the first time, strengthening the important role of BAG2 in Parkinson disease -related neurodegeneration.
24318877 we measured the binding of human Hsp72 (HSPA1A) to BAG1, BAG2, BAG3, and the unrelated NEF Hsp105. These studies revealed a clear hierarchy of affinities: BAG3 > BAG1 > Hsp105 >> BAG2.
16207813 The activity of BAG-2 resembles that of the previously characterized Hsc70 cochaperone and CHIP inhibitor HspBP1.
16169850 BAG2 binds to the carboxyl terminus of Hsp70-interacting protein (CHIP) and provides a cochaperone-dependent regulatory mechanism for preventing unregulated ubiquitylation of misfolded proteins by CHIP
15271996 BAG2 was directly phosphorylated at serine 20 in vitro by MAPKAPK2 and MAPKAP2 is also required for phosphorylation of BAG2 in vivo.

AA Sequence

MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMR      1 - 70
QISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYS     71 - 140
ACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRF    141 - 210
N//

Text Mined References (36)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26271008 2015 BAG2 promotes tumorigenesis through enhancing mutant p53 protein levels and function.
25985852 2015 BAG2 Is Repressed by NF-?B Signaling, and Its Overexpression Is Sufficient to Shift A?1-42 from Neurotrophic to Neurotoxic in Undifferentiated SH-SY5Y Neuroblastoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25006867 2015 The BAG2 and BAG5 proteins inhibit the ubiquitination of pathogenic ataxin3-80Q.
24681825 2014 The NLR-related protein NWD1 is associated with prostate cancer and modulates androgen receptor signaling.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24383081 2013 The BAG2 protein stabilises PINK1 by decreasing its ubiquitination.
More...