Property Summary

NCBI Gene PubMed Count 31
PubMed Score 102.36
PubTator Score 53.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 2.686 1.1e-02
aldosterone-producing adenoma -1.450 2.4e-02
Atopic dermatitis -1.400 1.4e-03
Breast cancer 2.600 2.6e-02
colon cancer -1.300 3.5e-02
cystic fibrosis 1.800 4.6e-04
ependymoma 1.200 1.3e-05
hereditary spastic paraplegia -1.226 1.2e-02
lung cancer 2.400 7.9e-04
oligodendroglioma -1.200 1.9e-02
osteosarcoma 2.885 4.1e-04
ovarian cancer -1.600 2.5e-06
psoriasis -1.100 9.6e-12
ulcerative colitis 2.200 1.5e-05

Synonym

Accession O95816 B4DXE2 Q08AS9 Q6FID0 BAG-2
Symbols BAG-2
dJ417I1.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMR      1 - 70
QISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYS     71 - 140
ACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRF    141 - 210
N//

Text Mined References (39)

PMID Year Title