Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.27
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count P-value
lung cancer 4740 2.8e-05
adult high grade glioma 3801 6.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Globe disease 67 0.0 1.1
Disease Target Count Z-score Confidence
Dyslexia 43 3.003 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.500 2.1e-05
adult high grade glioma -1.100 6.8e-05
lung cancer 1.900 2.8e-05

Gene RIF (3)

AA Sequence

MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV      1 - 70
DPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQILAIANASHLLTC     71 - 140
GTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAAVMAGGVLYAATVKNYLGTEPIITRAVGRAE    141 - 210
DWIRTDTLPSWLNAPAFVAAVALSPAEWGDEDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGR    211 - 280
KTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDI    281 - 350
RTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP    351 - 420
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENM    421 - 490
KLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSS    491 - 560
LCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACEC    561 - 630
QEGGAAHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGL    631 - 700
DLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI    701 - 770
//

Text Mined References (22)

PMID Year Title