Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.13
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
lung cancer 1.900 0.000
adult high grade glioma -1.100 0.000

Synonym

Accession O95754 Q542Y7 Q9NS35
Symbols S4F
SEMAM
SEMAW
M-SEMA
PRO2353
m-Sema-M

Gene

Gene RIF (3)

PMID Text
21925246 data seems to indicate that SEMA4F is involved in tumour progression in breast cancer
19056885 Sema4F levels were strongly reduced in a panel of human neurofibromas, confirming the relevance of these findings to the human disease.
11901358 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility candidate gene

AA Sequence

MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV      1 - 70
DPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQILAIANASHLLTC     71 - 140
GTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAAVMAGGVLYAATVKNYLGTEPIITRAVGRAE    141 - 210
DWIRTDTLPSWLNAPAFVAAVALSPAEWGDEDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGR    211 - 280
KTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDI    281 - 350
RTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP    351 - 420
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENM    421 - 490
KLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSS    491 - 560
LCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACEC    561 - 630
QEGGAAHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGL    631 - 700
DLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI    701 - 770
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
22685421 2012 Genetic variants on chromosome 1q41 influence ocular axial length and high myopia.
21945643 2012 Expression of Semaphorin 4F in neurons and brain oligodendrocytes and the regulation of oligodendrocyte precursor migration in the optic nerve.
21925246 2011 Semaphorin-plexin signalling genes associated with human breast tumourigenesis.
21625861 2012 Comprehensive gene and microRNA expression profiling reveals the crucial role of hsa-let-7i and its target genes in colorectal cancer metastasis.
21136834 2008 Proteomic approaches to the analysis of atopic dermatitis and new insights from interactomics.
19056885 2008 NF1 loss disrupts Schwann cell-axonal interactions: a novel role for semaphorin 4F.
19047084 2008 Cancer-related axonogenesis and neurogenesis in prostate cancer.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...