Property Summary

NCBI Gene PubMed Count 23
PubMed Score 481.63
PubTator Score 8.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.099 1.2e-02
astrocytoma 1.700 4.1e-02
Astrocytoma, Pilocytic 1.300 8.8e-07
Chronic Lymphocytic Leukemia -1.353 1.1e-03
cutaneous lupus erythematosus 2.100 4.9e-04
glioblastoma 2.300 4.6e-03
group 3 medulloblastoma -1.400 1.0e-03
interstitial cystitis 1.400 6.4e-03
intraductal papillary-mucinous adenoma (... -1.300 5.2e-03
intraductal papillary-mucinous carcinoma... -1.200 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.200 3.9e-02
invasive ductal carcinoma 1.506 4.5e-05
lung cancer -1.500 6.4e-03
lung carcinoma -2.200 2.7e-14
non-small cell lung cancer -2.053 1.8e-17
osteosarcoma -1.505 1.5e-02
primary Sjogren syndrome 1.400 4.7e-04
subependymal giant cell astrocytoma 1.932 9.0e-03
tuberculosis 1.600 4.5e-08

Gene RIF (11)

AA Sequence

MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF      1 - 70
GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV     71 - 140
LLELYTEKRSTVACANATIMCS                                                    141 - 162
//

Text Mined References (23)

PMID Year Title