Property Summary

NCBI Gene PubMed Count 21
Grant Count 8
R01 Count 4
Funding $458,269.41
PubMed Score 408.81
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
24735745 DNA methylation of the LY86 gene is associated with obesity, insulin resistance, and inflammation.
21959264 Both mouse and human RP105/MD-1 exhibit dimerization of the 1:1 RP105/MD-1 complex, demonstrating a novel organization.
21426727 MD-1 may be a disease susceptibility gene for adult asthma in a Southern Han population in China.
21130168 In this study, we produced variants of MD-1 and MD-2 in Pichia pastoris. Contrary to previous reports, this study suggests that MD-1 can bind to LPS.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19255686 Identified MD-1 SNP (rs7740529) association with asthma in Taiwanese children and adults.
19255686 Observational study of gene-disease association. (HuGE Navigator)
18001295 in the promoter region we identified 3 SNPs, rs1334710, rs4959389 and rs977785 that are associated with mite-sensitive allergy in Taiwanese children; results suggested that MD-1 could be a susceptible gene for mite-sensitive allergy in Taiwanese children
16907704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF      1 - 70
GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV     71 - 140
LLELYTEKRSTVACANATIMCS                                                    141 - 162
//

Text Mined References (21)

PMID Year Title
24735745 2014 DNA methylation of the LY86 gene is associated with obesity, insulin resistance, and inflammation.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
21959264 2011 Crystal structures of mouse and human RP105/MD-1 complexes reveal unique dimer organization of the toll-like receptor family.
21426727 2011 [Association of single nucleotide polymorphisms of MD-1 gene with asthma in adults of Han Nationality in Southern China].
21130168 2011 LPS ligand and culture additives improve production of monomeric MD-1 and 2 in Pichia pastoris by decreasing aggregation and intermolecular disulfide bonding.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
19255686 2008 Association of single nucleotide polymorphisms of MD-1 gene with pediatric and adult asthma in the Taiwanese population.
More...