Property Summary

NCBI Gene PubMed Count 163
PubMed Score 525.13
PubTator Score 275.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 1.2e-02
Breast cancer -1.400 3.4e-06
Chronic Lymphocytic Leukemia 1.199 3.4e-03
ependymoma 1.600 7.8e-07
gastric carcinoma 1.200 4.4e-02
group 4 medulloblastoma -1.200 8.7e-04
interstitial cystitis 2.000 1.8e-03
lung adenocarcinoma -1.080 9.6e-09
lung cancer -1.700 7.6e-05
lung carcinoma -1.200 6.4e-14
malignant mesothelioma 1.100 2.8e-05
ovarian cancer -1.100 2.1e-04
ulcerative colitis 1.100 9.0e-04

Gene RIF (158)

AA Sequence

MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCH      1 - 70
NLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVE     71 - 140
VEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCV    141 - 210
SPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPH    211 - 280
HSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKV    281 - 350
EPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP    351 - 420
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHA    421 - 490
FYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRV    491 - 560
RLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFV    561 - 630
EKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPI    631 - 700
IKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHD    701 - 770
LSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH    771 - 840
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIP    841 - 910
VTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS                                         911 - 943
//

Text Mined References (170)

PMID Year Title