Property Summary

NCBI Gene PubMed Count 145
PubMed Score 471.30
PubTator Score 275.55

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.41499264877566E-14
lung adenocarcinoma 2714 9.62467318034927E-9
malignant mesothelioma 3163 4.2204312469362E-8
ependymoma 2514 7.76531482033518E-7
Breast cancer 3099 3.42497337642003E-6
ovarian cancer 8492 4.62079955690186E-5
lung cancer 4473 7.63804934017757E-5
sonic hedgehog group medulloblastoma 1482 1.13009795113552E-4
ulcerative colitis 2087 8.95409312033398E-4
interstitial cystitis 2299 0.00181789409524363
chronic lymphocytic leukemia 244 0.00338831146723609
astrocytoma 1493 0.0116225225888359
gastric carcinoma 832 0.0440183759546988


  Differential Expression (13)

Disease log2 FC p
chronic lymphocytic leukemia 1.199 0.003
malignant mesothelioma 2.700 0.000
ependymoma 1.600 0.000
astrocytoma 1.200 0.012
lung cancer -1.700 0.000
interstitial cystitis 2.000 0.002
sonic hedgehog group medulloblastoma 2.200 0.000
lung adenocarcinoma -1.080 0.000
lung carcinoma -1.200 0.000
Breast cancer -1.400 0.000
gastric carcinoma 1.200 0.044
ulcerative colitis 1.100 0.001
ovarian cancer 1.600 0.000


Accession O95644 B5B2M4 B5B2M5 B5B2M6 B5B2M7 B5B2M8 B5B2M9 B5B2N1 Q12865 Q15793 Q2M1S3 NF-ATc1
Symbols NFAT2


PANTHER Protein Class (1)


1A66   1NFA  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (140)

26644563 Tmem178 localizes to the ER membrane and regulates RANKL-induced Ca(2+) fluxes, thus controlling NFATc1 induction
26644469 analysis of information transfer via gonadotropin-releasing hormone receptors to extracellular signal-regulated kinase or nuclear factor of activated T-cells
26601952 NFATc1binds the GLI1 promoter and represses its transcription.
26584734 Synergistic interactions between NFAT and Foxp3 determine Treg-specific GARP expression.
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26493727 DDIAS is a target of NFATc1 and is associated with cisplatin resistance in lung cancer cells.
26483414 that alternative N-terminal domains of NFAT2 could provide differential mechanisms for the control of cellular functions
26398575 InB may exhibit growth-inhibitory activity through the activation of PKCalpha, followed by an increase in NFAT transactivation ability.
26042420 A meta-analysis of the replication study data demonstrated that three chromosome 18 SNPs were associated with AAD, including a non-synonymous variant in the NFATC1 gene.
25976987 High NFATc1 expression is associated with acute myeloid leukemia.

AA Sequence

VTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS                                         911 - 943

Text Mined References (152)

PMID Year Title
26644563 2015 Tmem178 acts in a novel negative feedback loop targeting NFATc1 to regulate bone mass.
26644469 2016 Information Transfer in Gonadotropin-releasing Hormone (GnRH) Signaling: EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK)-MEDIATED FEEDBACK LOOPS CONTROL HORMONE SENSING.
26601952 2016 Nuclear Factor of Activated T Cells-dependent Down-regulation of the Transcription Factor Glioma-associated Protein 1 (GLI1) Underlies the Growth Inhibitory Properties of Arachidonic Acid.
26584734 2016 Methylation of an intragenic alternative promoter regulates transcription of GARP.
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26493727 2016 DNA damage-induced apoptosis suppressor (DDIAS), a novel target of NFATc1, is associated with cisplatin resistance in lung cancer.
26483414 2016 NFAT2 Isoforms Differentially Regulate Gene Expression, Cell Death, and Transformation through Alternative N-Terminal Domains.
26398575 2015 Protein kinase C?-mediated cytotoxic activity of ineupatorolide B from Inula cappa DC. in HeLa cells.
26042420 2015 Linkage Analysis in Autoimmune Addison's Disease: NFATC1 as a Potential Novel Susceptibility Locus.
25976987 2015 NFATc1 as a therapeutic target in FLT3-ITD-positive AML.