Property Summary

NCBI Gene PubMed Count 30
PubMed Score 285.56
PubTator Score 142.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mucoepidermoid carcinoma 26 4.677 2.3
Influenza 142 4.541 2.3
Hepatitis B 108 3.406 1.7

Expression

Protein-protein Interaction (12)

Gene RIF (10)

AA Sequence

MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKH      1 - 70
WLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRH     71 - 140
RHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQN    141 - 210
SSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ               211 - 269
//

Text Mined References (36)

PMID Year Title