Property Summary

NCBI Gene PubMed Count 45
Grant Count 27
R01 Count 19
Funding $2,133,974.44
PubMed Score 69.71
PubTator Score 58.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.128 0.001
non-small cell lung cancer -1.365 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.000
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.600 0.000
invasive ductal carcinoma -1.200 0.045

Gene RIF (30)

PMID Text
25937185 FSTL3 is a critical mediator of exercise-dependent bone formation
24700053 Elevated FSTL-3 concentrations were attributable to preeclampsia and were associated with increased likelihood of later developing preeclampsia, suggesting further study as a biomarker prior to clinically evident disease.
24475769 The elevation of Follistatin-like-3 was demonstrated in late second trimester of pregnancy destined to developing preeclampsia, suggesting its causal role in the pathogenesis and prediction of preeclampsia.
22915069 Suggest FSTL3 has a role in paracrine communication between cardiomyocytes and fibroblasts.
22568578 Data suggest that serum levels of FSTL3 are higher in pre-eclampsia than in controls; placental expression of FSTL3 is also increased in pre-eclampsia compared with controls; no differences were observed between mild and severe pre-eclampsia.
22476926 Resistance exercise resulted in a significant downregulation of MSTN and FBXO32 mRNA expression and a significant upregulation in FSTL3 and SMURF1 mRNA expression, and carbohydrate and protein feeding have little influence on the these markers expression.
22395277 After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed higher levels of follistatin-like protein 3 while postmenopausal women using HT showed a significant increased expression over controls.
22122995 Maternal and placental FSTL3 concentrations were reduced in GDM women compared with normally pregnant women, suggesting FSTL3 may play an important role in the pathogenesis of gestational diabetes
22052913 Structure of myostatin.follistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
21829661 GDF9 decreases basal and activin A-induced FST and FSTL3 expression, and this explains, in part, its enhancing effects on activin A-induced inhibin beta(B)-subunit mRNA expression and inhibin B production in hGL cells
More...

AA Sequence

MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTA      1 - 70
WSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGA     71 - 140
TYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQEL    141 - 210
CGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV                     211 - 263
//

Text Mined References (47)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25937185 2015 Follistatin-like 3 is a mediator of exercise-driven bone formation and strengthening.
24700053 2015 Follistatin-like 3 across gestation in preeclampsia and uncomplicated pregnancies among lean and obese women.
24475769 2014 Serum Follistatin-like-3 was elevated in second trimester of pregnant women who subsequently developed preeclampsia.
22915069 2012 Follistatin-like 3 mediates paracrine fibroblast activation by cardiomyocytes.
22568578 2012 Alterations of maternal serum and placental follistatin-like 3 and myostatin in pre-eclampsia.
22476926 2013 Effects of pre-exercise feeding on serum hormone concentrations and biomarkers of myostatin and ubiquitin proteasome pathway activity.
22395277 2012 Hormone therapy and maximal eccentric exercise alters myostatin-related gene expression in postmenopausal women.
22122995 2012 Decreased maternal and placental concentrations of follistatin-like 3 in gestational diabetes.
22052913 2012 Structure of myostatin·follistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
More...