Property Summary

NCBI Gene PubMed Count 46
PubMed Score 76.60
PubTator Score 58.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.128 1.3e-03
intraductal papillary-mucinous adenoma (... -1.100 1.3e-04
invasive ductal carcinoma -1.200 4.5e-02
lung adenocarcinoma -1.100 1.7e-05
lung carcinoma -1.600 1.3e-19
non-small cell lung cancer -1.365 1.2e-12

Gene RIF (31)

AA Sequence

MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTA      1 - 70
WSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGA     71 - 140
TYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQEL    141 - 210
CGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV                     211 - 263
//

Text Mined References (48)

PMID Year Title