Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.98
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.500 1.3e-04
lung cancer 1.300 2.7e-02
ovarian cancer -1.400 1.7e-05
posterior fossa group A ependymoma 1.100 2.0e-07
primitive neuroectodermal tumor 1.200 5.6e-03
X-linked cerebral adrenoleukodystrophy -1.500 6.9e-03

Gene RIF (2)

AA Sequence

MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAA      1 - 70
PSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKEN     71 - 140
FPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGS    141 - 210
KEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSS    211 - 280
EKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTR    281 - 350
ILKIIDEGLKRFIIEITFKFPG                                                    351 - 372
//

Text Mined References (12)

PMID Year Title