Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.419 0.035
medulloblastoma, large-cell 1.800 0.000
adult high grade glioma 1.300 0.003
group 3 medulloblastoma -1.100 0.024
ovarian cancer 1.800 0.000
psoriasis -1.200 0.000

Synonym

Accession O95561 Q8IY02
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKRELKASVPKFDKIPWLSEASLVNKPLVLSLPRRYPHTSATFLTSSKKNMNLPILFQVPDVLSKARRN      1 - 70
QCDSMLLRNQQLCSTCQEMKMVQPRTMKIPDDPKASFENCMSYRMSLHQPKFQTTPEPFHDDIPTESIHY     71 - 140
RLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKEPIGKTTRQ                               141 - 183
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.