Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.6e-10
ovarian cancer 8520 1.6e-09
medulloblastoma, large-cell 6241 3.3e-04
adult high grade glioma 3801 3.0e-03
group 3 medulloblastoma 4104 2.4e-02
osteosarcoma 7950 3.5e-02
Disease Target Count Z-score Confidence
Abdominal aortic aneurysm 9 3.142 1.6
Disease Target Count
Non-immune hydrops fetalis 11

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.300 3.0e-03
group 3 medulloblastoma -1.100 2.4e-02
medulloblastoma, large-cell 1.800 3.3e-04
osteosarcoma 1.419 3.5e-02
ovarian cancer 1.800 1.6e-09
psoriasis -1.200 2.6e-10

Gene RIF (1)

AA Sequence

MEKRELKASVPKFDKIPWLSEASLVNKPLVLSLPRRYPHTSATFLTSSKKNMNLPILFQVPDVLSKARRN      1 - 70
QCDSMLLRNQQLCSTCQEMKMVQPRTMKIPDDPKASFENCMSYRMSLHQPKFQTTPEPFHDDIPTESIHY     71 - 140
RLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKEPIGKTTRQ                               141 - 183
//

Text Mined References (6)

PMID Year Title