Property Summary

NCBI Gene PubMed Count 29
PubMed Score 25.98
PubTator Score 37.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.500 5.0e-04
Astrocytoma, Pilocytic 1.500 2.2e-06
Breast cancer 3.300 4.7e-02
chronic kidney disease 1.200 4.5e-02
colon cancer -1.900 4.3e-02
ductal carcinoma in situ 1.700 2.6e-03
ependymoma 2.500 8.8e-19
glioblastoma 1.800 2.8e-05
group 3 medulloblastoma -1.300 3.9e-03
intraductal papillary-mucinous adenoma (... 1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.7e-03
invasive ductal carcinoma 1.500 2.8e-02
lung cancer -1.400 3.2e-02
malignant mesothelioma -6.200 4.3e-09
nasopharyngeal carcinoma -2.000 5.5e-08
ovarian cancer 3.000 2.1e-05
pancreatic ductal adenocarcinoma liver m... -2.815 2.9e-03
pituitary cancer -2.400 4.1e-06
psoriasis -1.500 2.0e-05
spina bifida -1.867 4.4e-02
subependymal giant cell astrocytoma 2.216 1.3e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLID      1 - 70
CYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYE     71 - 140
AGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLG    141 - 210
PGRPRYSFLDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVK    211 - 280
VAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQD    281 - 350
SSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV    351 - 420
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGL    421 - 490
GFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS                       491 - 541
//

Text Mined References (29)

PMID Year Title