Property Summary

NCBI Gene PubMed Count 13
Grant Count 63
R01 Count 45
Funding $10,520,560.72
PubMed Score 493.52
PubTator Score 66.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytoma -2.100 0.000
posterior fossa group A ependymoma -3.500 0.000
glioblastoma multiforme -2.300 0.000
oligodendroglioma -1.900 0.000
group 3 medulloblastoma -1.500 0.048
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -1.700 0.007
interstitial cystitis -1.800 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.800 0.000
Pick disease -1.700 0.007
psoriasis -1.300 0.000

Synonym

Accession O95502
Symbols NPR

Gene

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19368810 study suggests that NCAM-120, alpha-dystroglycan, and NPR are candidate biomarkers in CSF for neurodegenerative diseases, and that the changes in the CSF level of NPR may be specific for Alzheimer's disease
16115696 The purpose of the present study was to assess the toxic effect of taipoxin in SCLC-cell lines and to determine if toxicity correlates to NPR and NP1 and NP2 expression levels.
9261167 non-AUG translation initiation site. Comparison of rat determined N-terminal amino acid sequence with cDNA sequence indicates that a CUG codon is used as an initiator codon and codes for a methionine. The CTG is present in cDNAs of mouse, rat, and human.

AA Sequence

MKFLAVLLAAGMLAFLGAVICIIASVPLAASPARALPGGADNASVASGAAASPGPQRSLSALHGAGGSAG      1 - 70
PPALPGAPAASAHPLPPGPLFSRFLCTPLAAACPSGAQQGDAAGAAPGEREELLLLQSTAEQLRQTALQQ     71 - 140
EARIRADQDTIRELTGKLGRCESGLPRGLQGAGPRRDTMADGPWDSPALILELEDAVRALRDRIDRLEQE    141 - 210
LPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAE    211 - 280
LEHGSSAYSPPDAFKISIPIRNNYMYARVRKALPELYAFTACMWLRSRSSGTGQGTPFSYSVPGQANEIV    281 - 350
LLEAGHEPMELLINDKVAQLPLSLKDNGWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGIL    351 - 420
ILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAA    421 - 490
FDVCKGRAKA                                                                491 - 500
//

Text Mined References (13)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19368810 2009 Neuronal pentraxin receptor in cerebrospinal fluid as a potential biomarker for neurodegenerative diseases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16497176 2006 Regulation of neuronal type genes in congestive heart failure rats.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115696 2005 Specific sensitivity of small cell lung cancer cell lines to the snake venom toxin taipoxin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10748068 2000 Biochemical interactions of the neuronal pentraxins. Neuronal pentraxin (NP) receptor binds to taipoxin and taipoxin-associated calcium-binding protein 49 via NP1 and NP2.
10591208 1999 The DNA sequence of human chromosome 22.
More...