Property Summary

NCBI Gene PubMed Count 13
PubMed Score 528.06
PubTator Score 66.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.800 1.0e-03
astrocytic glioma -1.300 4.1e-03
Astrocytoma, Pilocytic -1.800 9.3e-06
atypical teratoid / rhabdoid tumor -3.100 9.2e-06
ependymoma -2.500 3.8e-02
glioblastoma -1.800 4.4e-07
group 3 medulloblastoma -1.500 4.8e-02
interstitial cystitis -1.700 2.0e-03
malignant mesothelioma -1.700 1.4e-06
medulloblastoma, large-cell -3.300 3.0e-05
oligodendroglioma -1.900 2.8e-18
Pick disease -1.700 6.9e-03
primitive neuroectodermal tumor -1.700 6.8e-03
psoriasis -1.300 1.8e-71

Gene RIF (4)

AA Sequence

MKFLAVLLAAGMLAFLGAVICIIASVPLAASPARALPGGADNASVASGAAASPGPQRSLSALHGAGGSAG      1 - 70
PPALPGAPAASAHPLPPGPLFSRFLCTPLAAACPSGAQQGDAAGAAPGEREELLLLQSTAEQLRQTALQQ     71 - 140
EARIRADQDTIRELTGKLGRCESGLPRGLQGAGPRRDTMADGPWDSPALILELEDAVRALRDRIDRLEQE    141 - 210
LPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAE    211 - 280
LEHGSSAYSPPDAFKISIPIRNNYMYARVRKALPELYAFTACMWLRSRSSGTGQGTPFSYSVPGQANEIV    281 - 350
LLEAGHEPMELLINDKVAQLPLSLKDNGWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGIL    351 - 420
ILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAA    421 - 490
FDVCKGRAKA                                                                491 - 500
//

Text Mined References (13)

PMID Year Title