Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.05
PubTator Score 3.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.120 1.5e-02
acute quadriplegic myopathy 1.076 7.6e-06
adult high grade glioma 1.100 1.4e-03
Astrocytoma, Pilocytic 1.200 2.2e-04
atypical teratoid / rhabdoid tumor 1.900 6.9e-07
glioblastoma 1.400 5.3e-07
group 4 medulloblastoma 1.300 2.4e-04
interstitial cystitis 1.300 5.5e-03
intraductal papillary-mucinous adenoma (... 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
invasive ductal carcinoma 1.200 9.4e-04
medulloblastoma, large-cell 1.500 1.9e-06
non-small cell lung cancer 1.074 1.2e-12
osteosarcoma -1.488 1.1e-03
pancreatic cancer 1.300 6.2e-03
pancreatic carcinoma 1.300 6.2e-03
pituitary cancer -1.300 2.2e-04
posterior fossa group A ependymoma 1.100 1.8e-06
primitive neuroectodermal tumor 1.300 5.8e-05
spina bifida -1.144 3.7e-02
tuberculosis -1.700 1.7e-08
ulcerative colitis 1.400 1.2e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPV      1 - 70
SGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMPSSSFLPEANLPPPLNWQY     71 - 140
NYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPSLQNSFIKSGPSVPPLVNPPLPTTFQPGAPH    141 - 210
GPPPAGGPPPVRALTPLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNK    211 - 280
NPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRV    281 - 350
VNLLQERNMLPSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL    351 - 420
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRRPEVQNATIEF    421 - 490
MAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRTKIGFITFDSTIHFYGLQE    491 - 560
SLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPT    561 - 630
GGRMSVFQTQLPTLGVGALKPREEPNHRSSAKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLA    631 - 700
SLGCISRYSAGSVYYYPSYHHQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRS    701 - 770
TDLLSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV    771 - 840
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFPLFVLALLKQK    841 - 910
SFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNISDRTIPQPPILQLSVEKLSR    911 - 980
DGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQPMTDLPELDTPESARIIAFISWLREQRPFFP    981 - 1050
ILYVIRDESPMKANFLQNMIEDRTESALSYYEFLLHIQQQVNK                              1051 - 1093
//

Text Mined References (16)

PMID Year Title