Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.08
PubTator Score 3.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95486 A8MVW3 Q8WUV2 Q96GP7
Symbols

Gene

PDB

3EGX   2NUP   2NUT   3EGD  

 GO Function (1)

Gene RIF (3)

PMID Text
26156069 the association between Kv1.3 and the COPII cargo adaptor subunit isoform Sec24a
22820839 CstA, a secreted Brucella protein specifically interacts with human Sec24A.
17255961 Sec24 isoforms expand the repertoire of cargo for signal-mediated ER export, but are in part functionally redundant.

AA Sequence

MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPV      1 - 70
SGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMPSSSFLPEANLPPPLNWQY     71 - 140
NYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPSLQNSFIKSGPSVPPLVNPPLPTTFQPGAPH    141 - 210
GPPPAGGPPPVRALTPLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNK    211 - 280
NPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRV    281 - 350
VNLLQERNMLPSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL    351 - 420
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRRPEVQNATIEF    421 - 490
MAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRTKIGFITFDSTIHFYGLQE    491 - 560
SLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPT    561 - 630
GGRMSVFQTQLPTLGVGALKPREEPNHRSSAKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLA    631 - 700
SLGCISRYSAGSVYYYPSYHHQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRS    701 - 770
TDLLSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV    771 - 840
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFPLFVLALLKQK    841 - 910
SFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNISDRTIPQPPILQLSVEKLSR    911 - 980
DGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQPMTDLPELDTPESARIIAFISWLREQRPFFP    981 - 1050
ILYVIRDESPMKANFLQNMIEDRTESALSYYEFLLHIQQQVNK                              1051 - 1093
//

Text Mined References (15)

PMID Year Title
26156069 2015 Kv1.3 contains an alternative C-terminal ER exit motif and is recruited into COPII vesicles by Sec24a.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22820839 2012 A Brucella abortus cstA mutant is defective for association with endoplasmic reticulum exit sites and displays altered trafficking in HeLa cells.
21269460 2011 Initial characterization of the human central proteome.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
17499046 2007 The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope.
17255961 2007 Role of Sec24 isoforms in selective export of membrane proteins from the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
More...