Property Summary

NCBI Gene PubMed Count 42
Grant Count 92
R01 Count 66
Funding $7,412,875.63
PubMed Score 164.90
PubTator Score 439.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95479 Q4TT33 Q66I35 Q68DT3
Symbols GDH
G6PDH
CORTRD1

Gene

PANTHER Protein Class (2)

Gene RIF (32)

PMID Text
26452272 The G allele of rs6688832 in H6PD might exert potential genetic protective role against the development of PCOS, especially in overweight women. PCOS patients with AG genotype of rs6688832 might confer risk to the phenotype of hyperandrogenemia of PCOS.
26337086 Inhibition of glucose-6-phosphate dehydrogenase sensitizes cisplatin-resistant cells to death.
24631573 Cytoplasmic Mg2+ regulates glucose 6-phosphate utilization by reticular H6PD.
23979790 The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome.
23333304 HIV-1 Vif downregulates the expression of hexose-6-phosphate dehydrogenase (H6PD, glucose 1-dehydrogenase) in Vif-expression T cells
23125313 GR and p300 are involved in the induction of H6PD by cortisol in human amnion fibroblasts
22632162 HIV-1 Vif downregulates the expression of hexose-6-phosphate dehydrogenase (H6PD, glucose 1-dehydrogenase) in Vif-expression T cells
22306327 R453Q and D151A variants of the H6PD gene are associated with PCOS and obesity, respectively, and may contribute to the PCOS phenotype by influencing obesity, insulin resistance and hyperandrogenism.
22285204 Antioxidant supplementation was noted to increase G6PDH in the pentose phosphate cycle and 18S rRNA in the ribosome. There were no significant changes in the gene expression levels of beta-ACT
21869537 Polymorphisms in the H6PD gene may not be associated with type 2 diabetes and the metabolic syndrome.
More...

AA Sequence

MWNMLIVAMCLALLGCLQAQELQGHVSIILLGATGDLAKKYLWQGLFQLYLDEAGRGHSFSFHGAALTAP      1 - 70
KQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIF     71 - 140
YFSVPPFAYEDIARNINSSCRPGPGAWLRVVLEKPFGHDHFSAQQLATELGTFFQEEEMYRVDHYLGKQA    141 - 210
VAQILPFRDQNRKALDGLWNRHHVERVEIIMKETVDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELP    211 - 280
HNVSSAEAVLRHKLQVFQALRGLQRGSAVVGQYQSYSEQVRRELQKPDSFHSLTPTFAAVLVHIDNLRWE    281 - 350
GVPFILMSGKALDERVGYARILFKNQACCVQSEKHWAAAQSQCLPRQLVFHIGHGDLGSPAVLVSRNLFR    351 - 420
PSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLL    421 - 490
ESLAHKAPRLYPGGAENGRLLDFEFSSGRLFFSQQQPEQLVPGPGPAPMPSDFQVLRAKYRESPLVSAWS    491 - 560
EELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPE    561 - 630
SNFQGLQAHLLQHVRIPYYNIHPMPVHLQQRLCAEEDQGAQIYAREISALVANSSFDLVLLGMGADGHTA    631 - 700
SLFPQSPTGLDGEQLVVLTTSPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITTLVSRVGHEPKKWPI    701 - 770
SGVLPHSGQLVWYMDYDAFLG                                                     771 - 791
//

Text Mined References (47)

PMID Year Title
26452272 2015 Association Analysis between the Polymorphisms of HSD11B1 and H6PD and Risk of Polycystic Ovary Syndrome in Chinese Population.
26337086 2015 Inhibition of glucose-6-phosphate dehydrogenase sensitizes cisplatin-resistant cells to death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24631573 2014 Reduced cellular Mg²? content enhances hexose 6-phosphate dehydrogenase activity and expression in HepG2 and HL-60 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979790 2013 The expression of 11?-HSDs, GR, and H6PDH in subcutaneous adipose tissue from polycystic ovary syndrome subjects.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23132696 2013 Novel H6PDH mutations in two girls with premature adrenarche: 'apparent' and 'true' CRD can be differentiated by urinary steroid profiling.
23125313 2012 Involvement of GR and p300 in the induction of H6PD by cortisol in human amnion fibroblasts.
22306327 2012 The R453Q and D151A polymorphisms of hexose-6-phosphate dehydrogenase gene (H6PD) influence the polycystic ovary syndrome (PCOS) and obesity.
More...