Property Summary

NCBI Gene PubMed Count 53
Grant Count 96
R01 Count 54
Funding $18,818,936.95
PubMed Score 71.53
PubTator Score 68.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 0.001
ovarian cancer 1.500 0.002

Synonym

Accession O95453 B2RCB3 B4DDG8 B4DSB0 B4DWR4 B4E1H6
Symbols DAN
DKCB6
PFBMFT4

Gene

PDB

2A1R   2A1S   3CTR  

Gene RIF (28)

PMID Text
26950371 PARN increased telomerase RNA component levels by deadenylating telomerase RNA component, thereby limiting its degradation by EXOSC10.
26628368 we found a polyadenylation-dependent 3' end maturation pathway for the human telomerase RNA that relies on the nuclear poly(A)-binding protein PABPN1 and the poly(A)-specific RNase PARN.
26541675 results highlight the clinical significance of PARN and NOC on the survival in SCC diagnosed patients.
26482878 Mutations in the PARN gene cause dyskeratosis congenital.
26342108 Large monoallelic mutations of PARN can cause developmental/mental illness. Biallelic PARN mutations cause severe bone marrow failure and central hypomyelination.
26130707 The results indicate that the cellular level of miR-122 is determined by the balance between the opposing effects of GLD-2 and PARN/CUGBP1 on the metabolism of its 3'-terminus.
25893599 3 families with dyskeratosis congenita had key domain mutations in PARN shortening telomeres, reducing deadenylation, and downregulating TERC, DKC1, RTEL1, and TERF1.
25848748 PARN and RTEL1 mutation carriers had shortened leukocyte telomere lengths.
25499764 poly(A)-specific ribonuclease (PARN) was upregulated in gastric tumor tissues and gastric cancer cell lines MKN28 and AGS.
23388391 Both R3H and RRM domains were essential for the high affinity of long poly(A) substrate.
More...

AA Sequence

MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFG      1 - 70
LCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEER     71 - 140
QLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQR    141 - 210
KLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS    211 - 280
GKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRL    281 - 350
KETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFN    351 - 420
KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQ    421 - 490
VKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTA    491 - 560
PSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPA    561 - 630
TLFEVPDTW                                                                 631 - 639
//

Text Mined References (63)

PMID Year Title
26950371 2016 Inhibition of telomerase RNA decay rescues telomerase deficiency caused by dyskerin or PARN defects.
26628368 2015 A Polyadenylation-Dependent 3' End Maturation Pathway Is Required for the Synthesis of the Human Telomerase RNA.
26541675 2015 Poly(A)-specific ribonuclease and Nocturnin in squamous cell lung cancer: prognostic value and impact on gene expression.
26482878 2015 Poly(A)-specific ribonuclease (PARN) mediates 3'-end maturation of the telomerase RNA component.
26342108 2015 Bone marrow failure and developmental delay caused by mutations in poly(A)-specific ribonuclease (PARN).
26130707 2015 Destabilization of microRNAs in human cells by 3' deadenylation mediated by PARN and CUGBP1.
25893599 2015 Poly(A)-specific ribonuclease deficiency impacts telomere biology and causes dyskeratosis congenita.
25848748 2015 Exome sequencing links mutations in PARN and RTEL1 with familial pulmonary fibrosis and telomere shortening.
25499764 2015 Depletion of poly(A)-specific ribonuclease (PARN) inhibits proliferation of human gastric cancer cells by blocking cell cycle progression.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
More...