Property Summary

NCBI Gene PubMed Count 34
Grant Count 3
R01 Count 1
Funding $1,531,339
PubMed Score 86.75
PubTator Score 71.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.008
non-small cell lung cancer -2.402 0.000
lung cancer -6.700 0.000
lung carcinoma -5.800 0.000
ovarian cancer 2.100 0.001
facioscapulohumeral dystrophy 6.100 0.000

Synonym

Accession O95436 A5PL17 Q8N2K2 Q8WYA9 Q9P0V7 Sodium-phosphate transport protein 2B
Symbols NPTIIb
NAPI-3B
NAPI-IIb

Gene

PANTHER Protein Class (1)

Gene RIF (21)

PMID Text
26506223 SPAK and OSR1 are powerful stimulators of the intestinal Na+-coupled phosphate co-transporter NaPi-IIb
26156586 our data indicated that SLC34A2 could exert significantly suppressive effects on tumorigenesis and progression of NSCLC. SLC34A2 might provide new insights for further understanding the early pathogenesis of human non-small cell lung cancer
25017204 SLC34A2 might be associated with the initiation and progression of lung adenocarcinoma
23936189 Data indicate that humanized monoclonal antibody Rebmab200 and murine monoclonal antibody MX35 monoclonal antibodies had similar specificity for sodium phosphate transporter NaPi2b.
23164546 investigation revealed that the c.910A > T mutation in the SCL34A2 gene was responsible for pulmonary alveolar microlithiasis (PAM) patients in China
22553815 a comprehensive analysis indicates that SCL34A2 is the only gene of the several phosphate transporters genes whose expression differentiates normal from carcinoma samples, suggesting it might exert a major role in ovarian carcinomas.
22336687 identified 2 cases of pulmonary alveolar microlithiasis(PAM) with new mutations of SLC34A2 gene; identified the NaPi-IIb in a aortic valve; hypothesize that mutations in SLC34A2 may play a role in development of aortic valve calcification and arteriosclerosis
21956469 study provides the data on the pattern of NaPi2b expression and cellular localization in breast, lung and ovarian cancers
21716206 Upregulation of SLC34A2 gene expression in well-differentiated tumors may reflect cell differentiation processes during ovarian cancerogenesis and could serve as potential marker for ovarian cancer diagnosis and prognosis.
21036732 There was a significantly increased gene expression of SLC34A2 (normal tissues: 6.71+/-0.77; tumour tissues: 10.29+/-0.80) among breast cancer tissues compared with normal tissues.
More...

AA Sequence

MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPW      1 - 70
NLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIM     71 - 140
SNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRAAIPIIMGANIGTSITNTIVALMQVGDRSEF    141 - 210
RRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDK    211 - 280
KVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKC    281 - 350
QHIFVNFHLPDLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI    351 - 420
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNALRSSLQIALC    421 - 490
HFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLIPLTVFGLSLAGWRVLVGVGV    491 - 560
PVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC    561 - 630
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL              631 - 690
//

Text Mined References (37)

PMID Year Title
26506223 2015 Up-Regulation of Intestinal Phosphate Transporter NaPi-IIb (SLC34A2) by the Kinases SPAK and OSR1.
26156586 2015 The effects and mechanisms of SLC34A2 in tumorigenesis and progression of human non-small cell lung cancer.
25017204 2014 Elevated expression of SLC34A2 inhibits the viability and invasion of A549 cells.
23936189 2013 Rebmab200, a humanized monoclonal antibody targeting the sodium phosphate transporter NaPi2b displays strong immune mediated cytotoxicity against cancer: a novel reagent for targeted antibody therapy of cancer.
23164546 2013 SLC34A2 Gene mutation of pulmonary alveolar microlithiasis: report of four cases and review of literatures.
22553815 2012 In silico analysis and immunohistochemical characterization of NaPi2b protein expression in ovarian carcinoma with monoclonal antibody Mx35.
22336687 2012 SLC34A2 gene mutation may explain comorbidity of pulmonary alveolar microlithiasis and aortic valve sclerosis.
21956469 2011 Immunohistochemical analysis of NaPi2b protein (MX35 antigen) expression and subcellular localization in human normal and cancer tissues.
21716206 2011 Quantitative analysis of SLC34A2 expression in different types of ovarian tumors.
21036732 2010 SLC34A2 as a novel marker for diagnosis and targeted therapy of breast cancer.
More...