Property Summary

NCBI Gene PubMed Count 43
PubMed Score 115.22
PubTator Score 71.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer -6.700 1.1e-05
atypical teratoid / rhabdoid tumor 1.100 7.6e-03
facioscapulohumeral dystrophy 6.100 6.8e-26
lung carcinoma -5.800 1.6e-54
non-small cell lung cancer -2.402 5.9e-11
ovarian cancer 2.100 9.7e-04

 GWAS Trait (1)

Gene RIF (30)

AA Sequence

MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPW      1 - 70
NLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIM     71 - 140
SNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRAAIPIIMGANIGTSITNTIVALMQVGDRSEF    141 - 210
RRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDK    211 - 280
KVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKC    281 - 350
QHIFVNFHLPDLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI    351 - 420
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNALRSSLQIALC    421 - 490
HFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLIPLTVFGLSLAGWRVLVGVGV    491 - 560
PVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC    561 - 630
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL              631 - 690
//

Text Mined References (46)

PMID Year Title