Property Summary

NCBI Gene PubMed Count 26
PubMed Score 50.32
PubTator Score 29.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 6.6e-03
ovarian cancer 1.600 2.8e-04
Waldenstrons macroglobulinemia 1.152 1.7e-03

Gene RIF (9)

AA Sequence

MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI      1 - 70
NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG     71 - 140
VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT    141 - 210
LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP    211 - 280
EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF                281 - 338
//

Text Mined References (36)

PMID Year Title