Property Summary

NCBI Gene PubMed Count 10
PubMed Score 27.28
PubTator Score 10.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 3.0e-13
ovarian cancer 8520 1.7e-07
pancreatic ductal adenocarcinoma liver metastasis 1962 1.0e-03
Disease Target Count Z-score Confidence
Diabetic macular edema 7 3.784 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma 1.100 3.0e-13
ovarian cancer -1.100 1.7e-07
pancreatic ductal adenocarcinoma liver m... -1.919 1.0e-03

Gene RIF (4)

AA Sequence

MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDL      1 - 70
GVLSDPGSGLYDADSELDVFDAYLE                                                  71 - 95
//

Text Mined References (11)

PMID Year Title