Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $106,250
PubMed Score 24.53
PubTator Score 10.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.919 0.001
lung carcinoma 1.100 0.000
ovarian cancer -1.100 0.000

Synonym

Accession O95424 B2RAA7
Symbols MYLE

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
25008175 Reduced DEXI mRNA level was associated with type 1 diabetes risk alleles of CLEC16A.
23151489 The data indicates a possible regulatory role for multiple sclerosis-associated non-coding CLEC16A SNPs and a common control mechanism for the expression of CLEC16A, SOCS1 and DEXI.
21989056 DEXI is an unappreciated autoimmune disease candidate gene, and illustrate the power of the 3C approach in progressing from genome-wide association studies results to candidate causal genes
21901246 Silencing of DEXI leads to drug resistance in colon cancer.

AA Sequence

MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDL      1 - 70
GVLSDPGSGLYDADSELDVFDAYLE                                                  71 - 95
//

Text Mined References (11)

PMID Year Title
25008175 2014 Fine mapping and functional studies of risk variants for type 1 diabetes at chromosome 16p13.13.
23151489 2013 Multiple sclerosis-associated single-nucleotide polymorphisms in CLEC16A correlate with reduced SOCS1 and DEXI expression in the thymus.
21989056 2012 Long-range DNA looping and gene expression analyses identify DEXI as an autoimmune disease candidate gene.
21901246 2012 Identification of a potent epigenetic biomarker for resistance to camptothecin and poor outcome to irinotecan-based chemotherapy in colon cancer.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11472984 2001 Cloning of dexamethasone-induced transcript: a novel glucocorticoid-induced gene that is upregulated in emphysema.
11306815 2001 Analysis of DEXI/Dexi refines the organization of the mouse 7C and human 15q11-->q13 imprinting clusters.
More...