Property Summary

NCBI Gene PubMed Count 9
Grant Count 20
R01 Count 7
Funding $3,085,208.25
PubMed Score 159.66
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.300 0.000
glioblastoma 1.700 0.012
osteosarcoma 2.473 0.000
ependymoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
astrocytoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
primitive neuroectodermal tumor 1.100 0.000
acute quadriplegic myopathy 1.075 0.000
tuberculosis 1.200 0.000
diabetes mellitus -1.200 0.002
adult high grade glioma 1.200 0.004
subependymal giant cell astrocytoma 1.343 0.003
ovarian cancer 2.800 0.000

AA Sequence

MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL      1 - 70
ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIP     71 - 140
VFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAA    141 - 210
VLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL                          211 - 258
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...