Property Summary

NCBI Gene PubMed Count 42
Grant Count 116
R01 Count 67
Funding $16,854,209.01
PubMed Score 100.25
PubTator Score 59.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -1.300 0.017
astrocytic glioma -1.400 0.016
psoriasis 1.600 0.000
glioblastoma -3.300 0.000
oligodendroglioma -1.400 0.000
osteosarcoma -3.857 0.000
posterior fossa group A ependymoma -3.700 0.000
group 4 medulloblastoma -4.900 0.000
cystic fibrosis -3.954 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -5.600 0.000
primitive neuroectodermal tumor -2.500 0.007
Atopic dermatitis 1.100 0.001
lung cancer -1.600 0.001
sarcoidosis 1.700 0.046
interstitial cystitis 2.200 0.001
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -3.800 0.000
primary Sjogren syndrome 2.300 0.000
invasive ductal carcinoma 1.357 0.010
lung carcinoma -1.600 0.000
ulcerative colitis 2.600 0.000
ovarian cancer -1.300 0.008
Down syndrome -1.200 0.002

Synonym

Accession O95267 Q56CZ0 Q58G75 Q59HB1 Q5I3A8 Q6GV31 Q6NX39 Q7LDG6 Q9UI94 Q9UNN9
Symbols V
RASGRP
hRasGRP1
CALDAG-GEFI
CALDAG-GEFII

Gene

PDB

4L9M   4L9U  

Gene RIF (25)

PMID Text
26076219 This study aimed to replicate and verify the association of RASGRP1 tag single-nucleotide polymorphisms with T2D in a Chinese Han population.
23908768 present a crystal structure of a fragment of RasGRP1 in which the Ras-binding site is blocked by an interdomain linker and the membrane-interaction surface of RasGRP1 is hidden within a dimerization interface
22961080 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22116551 cooperation between aberrant expression of RasGRP1, a strong activator of Ras, and secondary gain-of-function mutations of NOTCH1 have an important role in T-cell leukemogenesis
21976405 remission in systemic lupus erythematosus activity associated with decreased RasGRP-1 expression in lymphocytes
21968647 PAQR10 and PAQR11 are able to interact with RasGRP1, a guanine nucleotide exchange protein of Ras, and increase Golgi localization of RasGRP1. The C1 domain of RasGRP1 is both necessary and sufficient for the interaction of RasGRP1 with PAQR10/PAQR11.
21966541 Basal LAT-diacylglycerol-RasGRP1 signals in T cells maintain TCRalpha gene expression.
21856938 SDF-1 treatment of T cells induced the formation of a novel molecular signaling complex containing RasGRP1, Galphai2, and ZAP-70.
21815871 This is the first study aimed at evaluating CalDAG-GEFI gene sequences in people with mucocutaneous bleeding of unknown cause.
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCI      1 - 70
QSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMF     71 - 140
KMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELS    141 - 210
EHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQ    211 - 280
VAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDF    281 - 350
KIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY    351 - 420
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYI    421 - 490
SQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAG    491 - 560
FLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGP    561 - 630
FTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQ    631 - 700
DTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLK    701 - 770
YAQKKIESLQLEKSNHVLAQMEQGDCS                                               771 - 797
//

Text Mined References (49)

PMID Year Title
26076219 2015 Common RASGRP1 Gene Variants That Confer Risk of Type 2 Diabetes.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24132900 2013 Genome-wide association study of atypical psychosis.
23908768 2013 Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22116551 2012 Aberrant expression of RasGRP1 cooperates with gain-of-function NOTCH1 mutations in T-cell leukemogenesis.
21976405 2011 Constitutive abnormal expression of RasGRP-1 isoforms and low expression of PARP-1 in patients with systemic lupus erythematosus.
21968647 2012 PAQR10 and PAQR11 mediate Ras signaling in the Golgi apparatus.
21966541 2011 Basal LAT-diacylglycerol-RasGRP1 signals in T cells maintain TCR? gene expression.
More...