Property Summary

NCBI Gene PubMed Count 48
Grant Count 24
R01 Count 18
Funding $2,218,720.21
PubMed Score 34.52
PubTator Score 38.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.400 0.000
non diabetic and post-ischemic heart fai... 1.100 0.039
diabetes mellitus 2.600 0.001
acute myeloid leukemia -3.500 0.046

Gene RIF (30)

PMID Text
26572825 This study demonstrates that CRL4(DDB2) is a novel ubiquitin ligase of HBO1.
26072331 Taken together, MYST2 is a repressed growth suppressor in AML mediating reduced acetylation of histone 4 at residue 5 and is associated with inferior AML patient survival.
25743411 Myst2-mediated histone acetylation may be required for recruitment of Oct4 to the Nanog promoter
24739512 Increase in the number of cells with cytoplasmic JADE1S correlated with activation of tubular cell proliferation and inversely correlated with the number of cells with nuclear JADE1S, supporting role of HBO1-JADE1 shuttling during organ regeneration.
24125069 Hbo1 modulated transcription by estrogen receptor-alpha. Hbo1 contributes to degradation of ER-alpha by ubiquitination through lysine 48.
24065767 alternate choice of subunits associated with HBO1 can switch its specificity between H4 and H3 tails
23955388 Phosphorylated Hbo1 expression is associated with breast cancer.
23707616 HBO1, but not SRC-2, expression was reduced in testes of patients with androgen insensitivity syndromes compared to normal testes.
23319590 Modulation of Fbxw15 levels was able to differentially regulate histone H3K14 acetylation and cellular proliferation by altering HBO1 levels.
23188630 Gemcitabine resistance is dependent on Plk1-mediated phosphorylation of Orc2 and Hbo1.
More...

AA Sequence

MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEP      1 - 70
AYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDI     71 - 140
DISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCP    141 - 210
LYHNLSADECKVRAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQK    211 - 280
EKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTW    281 - 350
YHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN    351 - 420
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKML    421 - 490
IDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQ    491 - 560
ALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT                       561 - 611
//

Text Mined References (58)

PMID Year Title
27270040 2016 KAT7/HBO1/MYST2 Regulates CENP-A Chromatin Assembly by Antagonizing Suv39h1-Mediated Centromere Inactivation.
27247147 2016 Functional analysis of HBO1 in tumor development and inhibitor screening.
26625199 2016 Human T-cell leukemia virus type-1-encoded protein HBZ represses p53 function by inhibiting the acetyltransferase activity of p300/CBP and HBO1.
26620551 2016 BRPF3-HBO1 regulates replication origin activation and histone H3K14 acetylation.
26572825 2015 UV Damage-Induced Phosphorylation of HBO1 Triggers CRL4DDB2-Mediated Degradation To Regulate Cell Proliferation.
26072331 2015 MYST2 acetyltransferase expression and Histone H4 Lysine acetylation are suppressed in AML.
25743411 2015 The histone acetyltransferase Myst2 regulates Nanog expression, and is involved in maintaining pluripotency and self-renewal of embryonic stem cells.
24739512 2014 Cell cycle-dependent chromatin shuttling of HBO1-JADE1 histone acetyl transferase (HAT) complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125069 2013 Histone acetyltransferase Hbo1 destabilizes estrogen receptor ? by ubiquitination and modulates proliferation of breast cancers.
More...