Property Summary

NCBI Gene PubMed Count 60
PubMed Score 96.64
PubTator Score 77.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
juvenile dermatomyositis 1189 7.02887652938966E-9
osteosarcoma 7933 9.48801365681524E-7
malignant mesothelioma 3163 2.02157603748777E-6
ulcerative colitis 2087 5.97809052335109E-6
ovarian cancer 8492 5.45997697838105E-5
Pick disease 1893 1.08908099772172E-4
psoriasis 6685 1.26232117806514E-4
dermatomyositis 967 1.80421488632025E-4
primary Sjogren syndrome 789 3.97443606813946E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.94312070603671E-4
primitive neuroectodermal tumor 3031 0.00132588956524458
Multiple myeloma 1328 0.00136935856654866
group 4 medulloblastoma 1875 0.00215350626656148
astrocytic glioma 2241 0.00255008996625346
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00428037123026171
ependymoma 2514 0.00445094709220628
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00489625324383666
Waldenstrons macroglobulinemia 765 0.00663954033385649
oligodendroglioma 2849 0.00672615389870891
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0104372642498236
glioblastoma 5572 0.0152410312393247
esophageal adenocarcinoma 737 0.0315122069209427
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.143 1.6

Expression

Synonym

Accession O95243 B4DZN2 D3DNC3 D3DNC4 E9PEE4 Q2MD36 Q7Z4T3 Q96F09
Symbols MED1

Gene

PANTHER Protein Class (2)

PDB

2MOE   3IHO   4DK9   4E9E   4E9F   4E9G   4E9H   4EA4   4EA5   4LG7   4OFA   4OFE   4OFH   5CHZ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (45)

PMID Text
26503472 these data suggest that MBD4 inactivation may contribute to tumorigenesis, acting as a modifier of mismatch repair-deficient cancer phenotype.
25358258 The ability of MBD4 to directly interact with and recruit USP7 to chromocenters implicates it as an additional factor that can potentially regulate Dnmt1 activity during cell proliferation.
25162968 MBD4 rs3138373 A>G and rs2005618 T>C single nucleotide polymorphisms were not associated with esophageal squamous cell carcinoma (ESCC) risk. rs3138355 GG genotype was associated with a decreased risk of ESCC among male patients and the elderly.
24434851 Interaction between DNMT1 and MBD4 is involved in controlling gene expression and responding to oxidative stress.
24004570 ERCC4 rs1800124 and MBD4 rs10342 non-synonymous single nucleotide polymorphism variants were associated with DNA repair capacity.
23316048 the crystal structure of MBD4 bound to 5-hydroxymethylcytosine further demonstrates that MBDMBD4 is able to recognize a wide range of 5-methylcytosine modifications
23027038 MBD4 Glu346Lys polymorphism is associated with the risk of cervical cancer in a Chinese population.
22848106 Crystal structures of human MBD4(catalytic domain) reveal that MBD4 uses a base flipping mechanism to specifically recognize thymine and 5-hydroxymethyluracil.
22560993 specificity of MBD4 for acting at CpG sites depends largely on its methyl-CpG-binding domain, which binds preferably to G.T mispairs in a methylated CpG site
21971312 MBD 4--a potential substrate for protein kinase X
More...

AA Sequence

MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSECNPLLQEPIA      1 - 70
SAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPED     71 - 140
FDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQESRGLSNFTST    141 - 210
HLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQ    211 - 280
KSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYED    281 - 350
TFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS    351 - 420
KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEV    421 - 490
ARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPED    491 - 560
HKLNKYHDWLWENHEKLSLS                                                      561 - 580
//

Text Mined References (64)

PMID Year Title
26503472 2015 Involvement of MBD4 inactivation in mismatch repair-deficient tumorigenesis.
25358258 2015 MBD4 interacts with and recruits USP7 to heterochromatic foci.
25162968 2015 Methyl-CpG binding domain 4 tagging polymorphisms and esophageal cancer risk in a Chinese population.
24434851 2014 MBD4 cooperates with DNMT1 to mediate methyl-DNA repression and protects mammalian cells from oxidative stress.
24004570 Inter-individual variation in nucleotide excision repair pathway is modulated by non-synonymous polymorphisms in ERCC4 and MBD4 genes.
23316048 2013 Structural basis of the versatile DNA recognition ability of the methyl-CpG binding domain of methyl-CpG binding domain protein 4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027038 2012 The MBD4 Glu346Lys polymorphism is associated with the risk of cervical cancer in a Chinese population.
22848106 2012 Biochemical and structural characterization of the glycosylase domain of MBD4 bound to thymine and 5-hydroxymethyuracil-containing DNA.
22560993 2012 Crystal structure of human methyl-binding domain IV glycosylase bound to abasic DNA.
More...