| Tbio | SAM pointed domain-containing Ets transcription factor |
May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Ovarian Neoplasms | 102 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| ovarian neoplasm | 99 |
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6694 | 7.3e-22 |
| ovarian cancer | 8520 | 1.0e-09 |
| lung adenocarcinoma | 2716 | 2.9e-09 |
| invasive ductal carcinoma | 2951 | 8.8e-05 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 3.0e-03 |
| uncontrolled asthma | 56 | 3.0e-03 |
| ductal carcinoma in situ | 1745 | 3.1e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 3.6e-03 |
| breast carcinoma | 1638 | 5.9e-03 |
| fibroadenoma | 559 | 1.2e-02 |
| primary Sjogren syndrome | 735 | 4.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| breast carcinoma | 1.600 | 5.9e-03 |
| ductal carcinoma in situ | 1.200 | 3.1e-03 |
| fibroadenoma | 2.100 | 1.2e-02 |
| intraductal papillary-mucinous adenoma (... | 1.400 | 3.0e-03 |
| intraductal papillary-mucinous carcinoma... | 1.700 | 3.6e-03 |
| invasive ductal carcinoma | 1.500 | 8.8e-05 |
| lung adenocarcinoma | 1.200 | 2.9e-09 |
| ovarian cancer | 1.100 | 1.0e-09 |
| primary Sjogren syndrome | -1.200 | 4.9e-02 |
| psoriasis | -1.800 | 7.3e-22 |
| uncontrolled asthma | 1.200 | 3.0e-03 |
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED 1 - 70 SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL 71 - 140 LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK 141 - 210 SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK 211 - 280 IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI 281 - 335 //
