Property Summary

NCBI Gene PubMed Count 45
Grant Count 49
R01 Count 34
Funding $5,898,076.24
PubMed Score 207.28
PubTator Score 66.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (38)

PMID Text
26965996 PDEF gene expression is associated with the extent of bladder neoplasia and PDEF modulated the expressions of EMT-related genes.
25376946 We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05).
25254494 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated).
24027338 Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold.
23921628 PDEF undergoes DNA methylation in breast cancer cells.
23764000 Prostate-derived ETS factor (PDEF) is identified as a mediator of mammary luminal epithelial lineage-specific gene expression and as a factor required for tumorigenesis in a subset of breast cancers.
23671562 Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell.
23665202 Data demonstrate that SPDEF is required for conjunctival goblet cell differentiation and down-regulation of SPDEF may play a role in human dry eye with goblet cell loss.
23592399 these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer
More...

AA Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED      1 - 70
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL     71 - 140
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK    141 - 210
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK    211 - 280
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI                   281 - 335
//

Text Mined References (46)

PMID Year Title
26965996 2016 Prostate-derived ets factor represses tumorigenesis and modulates epithelial-to-mesenchymal transition in bladder carcinoma cells.
25376946 2015 Enhanced expression of SAM-pointed domain-containing Ets-like factor in chronic rhinosinusitis with nasal polyps.
25254494 2014 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 2014 HOXB13 regulates the prostate-derived Ets factor: implications for prostate cancer cell invasion.
24027338 2013 Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter.
23921628 2013 Epigenetic modifications of prostate-derived Ets transcription factor in breast cancer cells.
23764000 2013 PDEF promotes luminal differentiation and acts as a survival factor for ER-positive breast cancer cells.
23671562 2013 Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model.
23665202 2013 Spdef null mice lack conjunctival goblet cells and provide a model of dry eye.
23592399 2013 Prostate derived Ets transcription factor and Carcinoembryonic antigen related cell adhesion molecule 6 constitute a highly active oncogenic axis in breast cancer.
More...