Property Summary

NCBI Gene PubMed Count 45
PubMed Score 207.28
PubTator Score 66.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
ovarian neoplasm 97
Disease Target Count P-value
psoriasis 6685 7.3073930895885E-22
lung adenocarcinoma 2714 9.24228731183411E-10
ovarian cancer 8492 7.17495551894716E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 4.24707467166614E-4
invasive ductal carcinoma 2950 6.16031425125203E-4
ductal carcinoma in situ 1745 0.00203323300265815
uncontrolled asthma 67 0.00300953174467918
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00304077148816832
breast carcinoma 1614 0.00585540668734512
fibroadenoma 557 0.0118006758627544
primary Sjogren syndrome 789 0.0486149236536001
Disease Target Count Z-score Confidence
Cancer 2346 3.527 1.8

Expression

  Differential Expression (11)

Synonym

Accession O95238 B4DWH8 F5H778
Symbols PDEF
bA375E1.3

Gene

PANTHER Protein Class (1)

PDB

1YO5   2DKX  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (38)

PMID Text
26965996 PDEF gene expression is associated with the extent of bladder neoplasia and PDEF modulated the expressions of EMT-related genes.
25376946 We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05).
25254494 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated).
24027338 Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold.
23921628 PDEF undergoes DNA methylation in breast cancer cells.
23764000 Prostate-derived ETS factor (PDEF) is identified as a mediator of mammary luminal epithelial lineage-specific gene expression and as a factor required for tumorigenesis in a subset of breast cancers.
23671562 Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell.
23665202 Data demonstrate that SPDEF is required for conjunctival goblet cell differentiation and down-regulation of SPDEF may play a role in human dry eye with goblet cell loss.
23592399 these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer
More...

AA Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED      1 - 70
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL     71 - 140
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK    141 - 210
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK    211 - 280
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI                   281 - 335
//

Text Mined References (46)

PMID Year Title
26965996 2016 Prostate-derived ets factor represses tumorigenesis and modulates epithelial-to-mesenchymal transition in bladder carcinoma cells.
25376946 2015 Enhanced expression of SAM-pointed domain-containing Ets-like factor in chronic rhinosinusitis with nasal polyps.
25254494 2014 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 2014 HOXB13 regulates the prostate-derived Ets factor: implications for prostate cancer cell invasion.
24027338 2013 Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter.
23921628 2013 Epigenetic modifications of prostate-derived Ets transcription factor in breast cancer cells.
23764000 2013 PDEF promotes luminal differentiation and acts as a survival factor for ER-positive breast cancer cells.
23671562 2013 Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model.
23665202 2013 Spdef null mice lack conjunctival goblet cells and provide a model of dry eye.
23592399 2013 Prostate derived Ets transcription factor and Carcinoembryonic antigen related cell adhesion molecule 6 constitute a highly active oncogenic axis in breast cancer.
More...