Tbio | SAM pointed domain-containing Ets transcription factor |
May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Comments
Disease | Target Count |
---|---|
ovarian neoplasm | 97 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 7.3073930895885E-22 |
lung adenocarcinoma | 2714 | 9.24228731183411E-10 |
ovarian cancer | 8492 | 7.17495551894716E-6 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 4.24707467166614E-4 |
invasive ductal carcinoma | 2950 | 6.16031425125203E-4 |
ductal carcinoma in situ | 1745 | 0.00203323300265815 |
uncontrolled asthma | 67 | 0.00300953174467918 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.00304077148816832 |
breast carcinoma | 1614 | 0.00585540668734512 |
fibroadenoma | 557 | 0.0118006758627544 |
primary Sjogren syndrome | 789 | 0.0486149236536001 |
Disease | log2 FC | p |
---|---|---|
uncontrolled asthma | 1.200 | 0.003 |
intraductal papillary-mucinous adenoma (... | 1.700 | 0.000 |
intraductal papillary-mucinous carcinoma... | 1.900 | 0.003 |
breast carcinoma | 1.600 | 0.006 |
fibroadenoma | 2.100 | 0.012 |
lung adenocarcinoma | 2.100 | 0.000 |
primary Sjogren syndrome | -1.200 | 0.049 |
ductal carcinoma in situ | 2.400 | 0.002 |
invasive ductal carcinoma | 2.800 | 0.001 |
ovarian cancer | 1.300 | 0.000 |
psoriasis | -1.800 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG |
C. elegans | EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
PMID | Text |
---|---|
26965996 | PDEF gene expression is associated with the extent of bladder neoplasia and PDEF modulated the expressions of EMT-related genes. |
25376946 | We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05). |
25254494 | SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene. |
24898171 | we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated). |
24027338 | Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold. |
23921628 | PDEF undergoes DNA methylation in breast cancer cells. |
23764000 | Prostate-derived ETS factor (PDEF) is identified as a mediator of mammary luminal epithelial lineage-specific gene expression and as a factor required for tumorigenesis in a subset of breast cancers. |
23671562 | Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell. |
23665202 | Data demonstrate that SPDEF is required for conjunctival goblet cell differentiation and down-regulation of SPDEF may play a role in human dry eye with goblet cell loss. |
23592399 | these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer |
More... |
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED 1 - 70 SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL 71 - 140 LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK 141 - 210 SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK 211 - 280 IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI 281 - 335 //
PMID | Year | Title |
---|---|---|
26965996 | 2016 | Prostate-derived ets factor represses tumorigenesis and modulates epithelial-to-mesenchymal transition in bladder carcinoma cells. |
25376946 | 2015 | Enhanced expression of SAM-pointed domain-containing Ets-like factor in chronic rhinosinusitis with nasal polyps. |
25254494 | 2014 | SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene. |
24898171 | 2014 | HOXB13 regulates the prostate-derived Ets factor: implications for prostate cancer cell invasion. |
24027338 | 2013 | Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter. |
23921628 | 2013 | Epigenetic modifications of prostate-derived Ets transcription factor in breast cancer cells. |
23764000 | 2013 | PDEF promotes luminal differentiation and acts as a survival factor for ER-positive breast cancer cells. |
23671562 | 2013 | Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model. |
23665202 | 2013 | Spdef null mice lack conjunctival goblet cells and provide a model of dry eye. |
23592399 | 2013 | Prostate derived Ets transcription factor and Carcinoembryonic antigen related cell adhesion molecule 6 constitute a highly active oncogenic axis in breast cancer. |
More... |