Property Summary

NCBI Gene PubMed Count 29
Grant Count 6
R01 Count 6
Funding $1,415,262
PubMed Score 34.76
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25961928 we identify KIF20A as a direct transcriptional target of FOXM1, involved in paclitaxel action and resistance
25953216 Kif20a expression was upregulated in pancreatic ductal adenocarcinoma and pancreatic neuroendocrine cancer compared with normal pancreas. Kif20a silencing resulted in inhibition of proliferation, motility, and invasion of pancreatic cancer cell lines.
25499221 Our results provide insight into the link between regulation of KIF20A-mediated trafficking of IGF2BP3-containing stress granules and modulation of the motility and invasiveness in pancreatic cancers.
24656812 Authors propose that phosphoregulation of MKlp2 by Cdk1/cyclin B1 ensures that activation of MKlp2 kinesin and relocation of the CPC occur at the appropriate time and space for proper mitotic progression and genomic stability.
23750214 targeting Aurora B to the cell cortex (or the equatorial cortex) by MKlp2 is essential for the maintenance of the ingressing furrow for successful cytokinesis
22887948 Used proteomics to identify the genistein-induced protein alterations in gastric cancer cells and found the silencing of KIF20A inhibited cell viability and induced G2/M arrest,& also increased cancer cell sensitivity to genistein inhibition.
22854760 Primary melanomas that were positive for KIF20A showed a significantly greater thickness than those that were negative, and patients with KIF20A+ melanoma tended to develop recurrence earlier.
19303298 Data demonstrate that Mklp2 and the chromosomal passenger complex mutually depend on each other for microtubule midzone localization, and that the association between the CPC and Mklp2 is negatively regulated by Cdk1.
15665285 Collaboration of RAB6KIFL and disc large homologue 5 is likely to be involved in pancreatic cancer.
15263015 Relocation of the Aurora B/INCENP/survivin passenger protein complex requires KIF20A (MKlp2).
More...

AA Sequence

MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLR      1 - 70
VRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLT     71 - 140
VKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVI    141 - 210
WLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETS    211 - 280
HRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQ    281 - 350
DAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS    351 - 420
GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCAST    421 - 490
YDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGK    491 - 560
EELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILK    561 - 630
ESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCK    631 - 700
AELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGK    701 - 770
LRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN    771 - 840
QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY                        841 - 890
//

Text Mined References (38)

PMID Year Title
25961928 2016 Paclitaxel targets FOXM1 to regulate KIF20A in mitotic catastrophe and breast cancer paclitaxel resistance.
25953216 2015 Kif20a inhibition reduces migration and invasion of pancreatic cancer cells.
25499221 2014 KIF20A-mediated RNA granule transport system promotes the invasiveness of pancreatic cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24656812 2014 Cdk1 coordinates timely activation of MKlp2 kinesin with relocation of the chromosome passenger complex for cytokinesis.
23750214 2013 Targeting Aurora B to the equatorial cortex by MKlp2 is required for cytokinesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22887948 2012 Genistein-induced mitotic arrest of gastric cancer cells by downregulating KIF20A, a proteomics study.
22854760 2012 Kinesin family member 20A is a novel melanoma-associated antigen.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...