Property Summary

Ligand Count 2
NCBI Gene PubMed Count 33
PubMed Score 39.56
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -1.100 3.2e-02
adrenocortical carcinoma 2.386 8.5e-05
adult high grade glioma 2.300 4.3e-05
Astrocytoma, Pilocytic 1.200 4.7e-04
Atopic dermatitis 2.400 6.6e-06
atypical teratoid / rhabdoid tumor 3.900 2.2e-13
Breast cancer 2.800 2.4e-02
breast carcinoma 1.600 5.4e-37
colon cancer 2.100 4.2e-04
ductal carcinoma in situ 2.500 1.1e-03
Endometriosis 2.448 8.7e-03
ependymoma 1.900 5.0e-07
glioblastoma 3.300 2.5e-10
group 3 medulloblastoma 4.500 1.2e-08
intraductal papillary-mucinous carcinoma... 2.400 3.3e-04
intraductal papillary-mucinous neoplasm ... 3.100 1.7e-03
invasive ductal carcinoma 3.100 5.2e-05
lung adenocarcinoma 1.100 3.0e-07
lung cancer 2.500 1.0e-03
malignant mesothelioma 1.200 6.4e-06
medulloblastoma, large-cell 4.500 1.2e-07
non-small cell lung cancer 2.858 1.1e-32
ovarian cancer 1.900 7.5e-06
pancreatic cancer 1.300 1.8e-04
primitive neuroectodermal tumor 4.100 3.7e-07
psoriasis 1.200 3.4e-05

Protein-protein Interaction (6)

Gene RIF (17)

AA Sequence

MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLR      1 - 70
VRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLT     71 - 140
VKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVI    141 - 210
WLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETS    211 - 280
HRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQ    281 - 350
DAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS    351 - 420
GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCAST    421 - 490
YDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGK    491 - 560
EELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILK    561 - 630
ESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCK    631 - 700
AELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGK    701 - 770
LRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN    771 - 840
QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY                        841 - 890
//

Text Mined References (42)

PMID Year Title