Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.48
PubTator Score 8.67

Knowledge Summary

Patent (2,084)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Gene RIF (1)

AA Sequence

MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPMYFFLANMSFL      1 - 70
EIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLLAVMAYDRYMAICYPLHYPVI     71 - 140
VSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIINHFFCDVSPLLNLSCTDMSTAELTDFILAIF    141 - 210
ILLGPLSVTGASYVAITGAVMHIPSAAGRYKAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVS    211 - 280
VLYAVIVPLLNPIIYCLRNQEVKRALCCTLHLYQHQDPDPKKASRNV                           281 - 327
//

Text Mined References (6)

PMID Year Title